KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0667500-01Help
Entry
Os04t0667500-01   CDS       T02163                                 

Gene name
Os04g0667500
Definition
Similar to Candida glabrata strain CBS138 chromosome C complete sequence.
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os04t0667500-01 (Os04g0667500)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Os04t0667500-01 (Os04g0667500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(34077139..34077234,34076853..34077035))
AA seq 92 aa AA seqDB search
MAAVPSAAAPPVPVSPGERWPPLESSPDVFNQLMWSLGVPEDVAEFHDVYSLDADALEMV
PQPVLAVVFCFPDPTQVHSSLCSRICFLFREF
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtgccctccgccgccgcgccgccggttccggtctcccccggcgagagatgg
ccgccgctcgagtcgagccccgacgtattcaaccagctcatgtggtcgctgggtgtcccg
gaggacgtggcggagttccacgacgtgtacagcctcgacgccgatgcgctggagatggtg
ccccagcctgtgctcgccgtcgtcttctgcttccccgatccaacccaggtgcattcatca
ctttgctccagaatttgttttctgtttcgcgagttttga

DBGET integrated database retrieval system