KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0669500-01Help
Entry
Os04t0669500-01   CDS       T02163                                 

Gene name
Os04g0669500
Definition
Phospholipase/carboxylesterase domain containing protein.
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os04t0669500-01 (Os04g0669500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Os04t0669500-01 (Os04g0669500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:complement(join(34150379..34150670,34150237..34150289,34150030..34150153,34149819..34149940,34148628..34148735,34148427..34148528))
AA seq 266 aa AA seqDB search
MSSRLRFLFSLAAAIAAASLLAAALRRRAPPSGLAARLVPAPMAAAAARNRSFVLWLHGL
GDSGPANEPIRNFFSAPEFRLTKWAFPSAPNSPVSCNHGAVMPSWFDIHELPMSSGSPQD
DSGVLKAVENVHAMIDKEVADGIPPENIFVCGFSQGGALTLASVLLYPKTLGGGAVFSGW
LPFGSSVTERISPEARKTPILWSHGIADNVVLFEAGQAGPPFLQNAGFSCEFKAYPGLGH
SISKEELYSLESWIKNHLKASQEKEN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccgcctccgcttcctcttctccctcgccgccgccatcgccgcagcctccctc
ctcgccgccgccctccgccgccgcgcgccgccctccggcctcgccgcccgcctcgtcccc
gcgcccatggcggcggcggcggcccgcaaccggagcttcgtgctgtggctgcacggactc
ggcgactccggcccggccaacgagcccatccgcaacttcttctccgcgccggagttccgc
ctcaccaagtgggcgttcccctccgccccgaactcccccgtctcctgcaaccatggcgct
gtgatgccttcatggttcgacatccacgagctacccatgagctctggttctccacaagat
gacagtggggttcttaaggctgttgaaaatgtgcacgccatgattgataaggaggtagct
gatggcatccctccagagaacatatttgtttgtggattcagtcaaggaggtgctctcaca
ttagcaagtgttttgctttatcccaagactctaggtggtggcgcagtgttcagtgggtgg
ctgccttttggttcgtcagttactgagaggatttcacctgaagcaaggaagactccaatt
ctgtggtcacatggaatagctgacaatgtagtattgtttgaagctggtcaagctggtcca
ccttttttgcaaaatgctggtttcagttgtgaatttaaggcatatccaggtcttggtcac
tcgatttccaaggaagagctatattctcttgagtcttggatcaagaatcatctaaaggcc
tctcaggagaaggaaaattaa

DBGET integrated database retrieval system