KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0680000-00Help
Entry
Os04t0680000-00   CDS       T02163                                 

Gene name
Os04g0680000
Definition
Similar to predicted protein.
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Os04t0680000-00 (Os04g0680000)
  Replication and repair
   03420 Nucleotide excision repair
    Os04t0680000-00 (Os04g0680000)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Os04t0680000-00 (Os04g0680000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr04:join(34725441..34725553,34725646..34725813,34726431..34726499,34726989..34727082,34727234..34727334,34727825..34727870,34727956..34728015,34728113..34728181,34728654..34728737,34728809..34728892,34729042..34729127,34729723..34729813,34729893..34729973,34730055..34730129,34730256..34730390)
AA seq 451 aa AA seqDB search
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSLPPLAKKYALQMLYVSAPVAA
AAMEEWVLDEYAAKHRVAIDRLLQLRVFVEVRDRRKEVSYKMNQKFQGNMQKYLVDGGSL
PREPIPSSVTARLPTLAELESFALEQWECFLLQLINSSQVERGTSFSSSMMRTFQRGLLS
SRDGEAPRLTENGFQFLLMETNAQLWYIMREYISSAEERGVDPTELISFLLELSFHTLGE
AYSLNTLTDVQRNAIRDLAELGLVKLQQGRKDSWFIPTKLATNLSASLSDSSSNKEGFVV
VETNFRMYAYSTSRLHCEILRLFSRVEYQLPNLIVGSITKESLYGAFENGITAEQIISFL
QQNAHPRVADKIPAVPENVTDQIRLWETDRNRVDMTLSHLYEDFPSKDMFDQCCDYARDH
GCLLWEDAKKMRLIVRVEFHSEMREFLRRLR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtaatggtggtcgcgcggaacttcatggacatggtggccgcgctgccggcc
gccaagctcgacatgctctacgactccgccttcatctgcgaggccgtgctcaggtcgctc
ccgccgctcgcgaagaagtacgcgctgcagatgctgtacgtgtcggcgccggtggccgct
gcggccatggaggagtgggtgctcgacgagtacgccgccaagcacagggtcgccatcgat
aggctgctccaactgagggtatttgtcgaggtgcgcgatcgaagaaaggaggtgagctac
aagatgaaccagaagttccagggcaacatgcaaaagtatttggttgatggtggaagttta
ccaagggaacctataccatcgagtgtcactgcaaggttgcctacattggcagaattagag
tcttttgctcttgagcagtgggagtgcttcttgctgcaattgatcaactcatctcaagtc
gagagagggacaagtttcagctcatccatgatgagaacttttcagcgaggtcttctgagt
tcaagagatggtgaagctccaagattaactgagaacgggttccagtttctgctgatggag
acaaatgctcaactttggtacatcatgagagaatacatctcatcagcagaggaacgtggt
gtggaccccacggagttgatatcatttctattggaacttagttttcatacattaggagag
gcttatagcttgaatactctgaccgatgtccaaagaaatgctattagggatctggcggag
ttgggactggtcaaacttcagcagggtcgaaaggacagctggttcatacctacaaaactg
gctacaaatctctcagcaagcttgtcagattcatcgtctaacaaagagggttttgtagtt
gtggagacaaatttccggatgtatgcgtactcaacttccagattacattgtgaaattctg
cgccttttttcaagagtggagtatcaacttccaaacctaattgtgggatctattacaaaa
gaaagtctttatggtgcttttgagaatgggattaccgctgaacagataatttcattcctt
cagcagaatgctcatcctcgtgttgctgacaagatacctgcagtcccagagaacgttaca
gatcagattaggttgtgggaaacggatcgtaacagggttgatatgaccctatcgcattta
tatgaagattttccaagcaaggatatgtttgatcaatgctgtgattatgcaagagatcat
gggtgcttgctgtgggaggatgcgaagaagatgagattaattgtacgagtggagttccat
tcagaaatgcgtgagttcctccggaggctaagataa

DBGET integrated database retrieval system