KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0127200-01Help
Entry
Os05t0127200-01   CDS       T02163                                 

Gene name
Os05g0127200
Definition
Similar to Phospholipase C (Fragment).
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Os05t0127200-01 (Os05g0127200)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Os05t0127200-01 (Os05g0127200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Os05t0127200-01 (Os05g0127200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(1536027..1536368,1537845..1538041,1538875..1539010,1539105..1539577,1539686..1539803,1540161..1540310,1540438..1540524,1540935..1541228)
AA seq 598 aa AA seqDB search
MTTYRVCCFLRRFRAASNEPSEELGDVFQAYADGGGGVMGEEALRRFLREVQGEAAGGGD
DELEATAREVMAFAAEQRLLRKGGAAAAGGGLTVEGFHRWLCSDANAALDPQKRVYQDMG
LPLSHYFIYTGHNSYLTGNQLSSGCSEVPIVKALHDGVRVIELDLWPNAAKDAVEVLHGR
TLTSPVGLMKCLEAIREYAFVASPYPVILTLEDHLTPDLQSKVAKMIKETFGDMLYVSET
ENMAEFPSPDELKGKIIVSTKPPKEYLQTKNDADADEAGVWGEEITDDKVAATAMTTEEK
CAAAEEAVAAAAVDEEMQEAETDKKTQHGVDNEYRRLIAIPLTRRKHDMDQDLKVDPDMV
TRLSLGEKAYEKAIVTHGAHIIRFTQRKLLRIFPRSTRITSSNYNPLMGWRYGVQMVAAN
MQGHGRKLWLTQGMFRANGGCGYVKKPDILMNNDPDKLFDPTSKLPVKTRLKVTVYMGDG
WRFDFRKTHFDKCSPPDFYARVGIAGVEADTRMEQTKVKMDTWIPAWDHEFEFPLSVPEL
ALLRVEVHESDNHQKDDFGGQTCLPVWELRRGIRSVRLCDHRGEPLRSVKLLMRFDFT
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtacagggtgtgctgcttcctgcggcggttcagggcggcgtcgaacgagccg
tcggaggagctcggcgacgtgttccaggcgtacgccgacggcggcggcggcgtgatgggg
gaggaggcgctgaggcggttcctccgggaggtgcagggggaggccgccggcggcggcgac
gacgagctggaggcgacggcgagggaggtgatggccttcgcggcggagcagaggctgctc
aggaagggcggcgccgctgccgccggcggcgggctcaccgtcgagggcttccaccgctgg
ctgtgcagcgacgccaacgctgcactggatcctcagaaacgggtatatcaagacatggga
ttgcctctgtcacactacttcatctacacggggcacaactcatacctgacggggaaccag
ctgagcagcgggtgcagcgaggtgcccatcgtgaaggccctccacgacggcgtccgtgtc
atcgagctcgacctctggcccaacgctgccaaggacgccgtcgaggtcctccacggcagg
acgctgacatcgccagtgggtctgatgaaatgccttgaggccatcagggagtacgcgttc
gtcgcctccccttaccccgtcatcctcaccctcgaagatcacctcactcccgacctccaa
tccaaagtcgccaagatgatcaaggagacgttcggtgacatgctctacgtctctgaaact
gagaacatggcggaattcccttcgccggacgagctcaaggggaagatcatcgtgtcgacg
aagccgcccaaggagtacctccagaccaagaacgacgccgacgccgacgaggccggcgtc
tggggcgaggagatcaccgacgacaaggtggcggcgacggcgatgacgacagaagagaaa
tgcgcggcggcggaggaagcagtcgccgccgccgccgtcgacgaggagatgcaggaggcc
gagacggacaagaagacgcagcacggggtggacaacgagtacaggcgcctcatcgccatc
cctctgacaagaagaaagcacgacatggatcaggacctcaaggtcgatcccgacatggtg
acgcgcctcagcctcggggagaaggcctacgagaaggccattgtcacccatggagctcac
attatcaggtttacgcagaggaaattgctgaggatattccctcggtcgacgcgcattacg
tcttcgaattataatcctttgatgggttggaggtatggagttcagatggttgcagcaaac
atgcagggccatggaagaaagctgtggctgactcaggggatgttccgagcaaacggcggt
tgcggttacgtcaaaaagcctgatattctgatgaacaacgatccagataaactgtttgat
cctacatccaaactaccagtaaagacaagactaaaggtgacggtgtacatgggagacgga
tggcgattcgacttccgcaagacacatttcgacaaatgctcacccccagacttctatgca
agggtgggtatagccggagtagaagcagacacgaggatggagcagacgaaggtgaagatg
gacacgtggattccggcatgggatcacgagttcgagttcccgttgagcgtgccggagctg
gcgctgctccgggtggaggtgcacgagtccgacaaccaccagaaggacgacttcggcggg
cagacctgcctgccggtgtgggagctccggcgaggcatccgctccgtcaggctctgcgac
caccgcggcgagcccctccgctccgtcaagctcctcatgcgcttcgacttcacctga

DBGET integrated database retrieval system