KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0156300-01Help
Entry
Os05t0156300-01   CDS       T02163                                 

Gene name
Os05g0156300
Definition
Similar to protein disulfide isomerase.
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os05t0156300-01 (Os05g0156300)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os05t0156300-01 (Os05g0156300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:complement(join(3297824..3297996,3297260..3297344,3296952..3297049,3296807..3296862,3296345..3296462,3296224..3296251,3296040..3296131,3295640..3295796,3295433..3295557,3295247..3295349,3295088..3295156))
AA seq 367 aa AA seqDB search
MATPQISRKALASLLLLVAAAAAVSTASADDVLALTESTFEKEVGQDRAALVEFYAPWCG
HCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKY
EGQRTAEALAEYVNSEAATNVKIAAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGH
CKHLAPIYEKLASVYKQDEGVVIANLDADKHTALAEKYGVSGFPTLKFFPKGNKAGEDYD
GGRELDDFVKFINEKCGTSRDSKGQLTSEAGIVESLAPLVKEFLGAANDKRKEALSKMEE
DVAKLTGPAANRYGKIYVNSAKKIMEKGSEYTKKESERLQRMLEKSISPSKADEFVIKKN
ILSTFSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcctcagatctcgcgcaaagccctcgcctccctcctcctcctcgtcgccgcc
gccgccgcggtctccaccgcgtccgccgacgacgtgctcgccctcaccgagtccaccttc
gagaaggaggtcggccaggaccgcgccgccctcgtcgagttctacgcgccatggtgtggt
cactgcaagaagcttgcccctgaatacgaaaaactcggtgcaagtttcaagaaagccaaa
tcagtcctaattgcgaaggttgactgtgatgagcacaagagtgtgtgcagcaagtatgga
gtttctgggtaccccacaatccaatggttccccaaaggttccttggagcccaagaagtat
gaaggtcaacgtaccgcggaagcccttgcagaatatgttaactctgaagcagccaccaat
gtaaagatagctgcagttccttctagtgtcgtggttcttaccccagagaccttcgactct
gttgtccttgatgaaaccaaagatgtccttgtagagttctatgccccatggtgtggtcac
tgcaagcatcttgctccgatttatgagaagctagcttctgtttataagcaagatgagggt
gttgttattgccaatcttgatgctgacaaacacactgccttggcagagaagtatggagtt
tctggtttccccacattgaaattcttcccaaagggaaacaaagctggtgaagattatgat
ggcggtcgcgagttggatgacttcgtcaagtttattaatgagaaatgtggaaccagccgt
gattcaaagggtcagcttacttcagaggctggcattgtcgaaagcttggctcctcttgtg
aaggagttccttggtgcagcaaatgataagcggaaagaagccctctccaaaatggaagag
gatgttgcgaagctcactggccctgctgccaacaggtacggaaagatctatgtgaactct
gcaaagaagatcatggagaagggctctgaatacactaagaaggaatctgagaggcttcaa
cgcatgttggagaagtcgatcagtccttccaaagccgatgaattcgtcatcaagaagaac
atcctttcgactttctcctcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system