KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0235300-01Help
Entry
Os05t0235300-01   CDS       T02163                                 

Gene name
Os05g0235300
Definition
PIK-related kinase domain containing protein.
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Os05t0235300-01 (Os05g0235300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(8276984..8277043,8277152..8277204,8277400..8277523,8278032..8278214,8279044..8279196,8279501..8279653,8279738..8279809,8279895..8280029,8280104..8280165,8280364..8280461,8280993..8281102,8281197..8281370,8281457..8281522,8282212..8282280,8282354..8282464,8282783..8282923,8283003..8283131,8283229..8283394,8283539..8283753,8285248..8285454,8286262..8286375,8286455..8286646,8286854..8286934,8287019..8287093,8287177..8287243,8287657..8287817,8288308..8288481,8288574..8288702,8288786..8288869,8288954..8289015,8289093..8289165,8289373..8289507,8290155..8290325,8290419..8290684,8290805..8290823)
AA seq 1427 aa AA seqDB search
LVDIRRRAIVTLTKLIPTVQVGTHVSVLVHHLKLVLDGNNDDLRKDAAEALCCLAHALGE
DFTIFVSSIHKLLVKHHMRYRKWDEIENRLLRREPLISENLSVQKYTQCPPEVISDPLDD
FGGVPSEEADETQRQPRSHQVNDVRLRSAGEASQRSTREDWAEWMRHFSIALLKESPSPA
LRTCARLAQLQPSVGRELFAAGFASCWAQMNETSQEQLVRSLKTAFSSQNIPPEILATLL
NLAEFMEHDEKPLPIDTRLLGALAEKCRAFAKALHYKEMEFEAVCSKKMGANPVTVVESL
IHINNQLHQHEAAIGILTYSQQHLEVQLKESWYEKLHRWDEALKAYKAKSSQASGPLQNL
DATLGRMRCLAALARWEDLSALCREQWTGSEPSARLEMAPMAANAAWHMGEWDHMAEYVS
RLDDGDENKLRILGNTTASGDGSSNGAFFRAVLSVRCKKYEEARVYVERARRCLATELAA
LVLESYERAYNNMVRVQQLSELEEVIDYCTLPMESPIADSRRELIRNMWNERIKGTKRNV
EVWQALLAVRELVLPPNEDRDTWIKFAKLCWKSGRISQAKSTLVKLLQFDPESSPELTLY
HGHPQVVLAYLKYQYAVGDELKRRDAFCRLQDLSVQLATATNSYSGTLASQVATSNAGVP
LIARVYLTLASWKRALSPGLDDDSIQEILVSYKNATLNAKDWGKAWHLWALFNTEVMSRY
TLRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILRLLTLWFNHGATSEVQMAL
QKGFSLVNIEMWLVVLPQIIARIHSNNKIVRELIQSLLVRIGKDHPQALMYPLLVACKSI
SILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHEMWHEALEEASRMYFGEHN
IEGMLAVLEPLHAMLERGPETIKENTFIQAYGHELLEAHECCLKYRATGEDAELTKAWDL
YYHVFRRIDKQLPSLTTLDLHSVSPELLECRKLELAVPGTYSADAPLVTIEYFVPQLIVI
TSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLVNTLLENSRKTSEKDLSIQ
RYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEHRCMLSFAPDYDHLPLIAK
VEVFQHALENSEGNDLAKVLWLKSRTSEVWLERRTNYTRSLAVMSMVGYLLGLGDRHPSN
LMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGTFRTTCENV
MQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQVTNYGNAHSHTVVNSEEAANRELM
QPPRGARERELLQAVNQLGDANEVLNERAVAVMARMSHKLTGRDFSSGSSLSGAGSSTQH
GNEHLASGDTREVEPGLSVKVQVQRLILQATSHENLCQNYVGWCPFW
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
ctagttgatatcagacgccgtgccattgtcactttgactaaactcatacctacggtgcag
gttggtactcatgtttcggttttggtgcatcatctaaagctagttttggatggaaacaat
gatgatctacggaaagatgcagcagaggcgctttgttgtcttgcacatgctcttggagaa
gattttacaatattcgtgtcatcaatacacaagcttcttgtgaagcaccatatgcggtat
agaaaatgggatgagattgaaaatcgattactaaggcgagagccactcatctctgagaac
ttatcagtacaaaagtacacacaatgcccgcctgaagtcattagtgaccctcttgatgat
tttggtggtgttccttctgaggaggctgatgaaacacagcggcaaccaagaagtcatcaa
gtcaatgatgttcgactgagaagtgccggtgaggcttctcaaaggagcactagagaagat
tgggctgaatggatgaggcacttcagtattgcgcttctcaaagaatcaccatctcctgct
ttacgcacttgcgcaagactagcacaacttcagccttctgttggtcgtgagttgtttgct
gcgggctttgcaagttgctgggcccaaatgaatgaaacatcccaggagcaacttgtgaga
agtctcaagactgcattctcatctcagaacatacctccagaaattcttgccacactgctg
aacttggcagagtttatggaacatgatgagaagccgcttccaattgatacaagactgctc
ggtgcacttgctgaaaagtgtcgagcatttgcaaaagcactgcattataaagaaatggag
tttgaagctgtatgttccaagaagatgggtgcaaatcctgttactgttgttgaatctctt
attcatattaacaaccaattacaccagcatgaggcagctattgggatattgacttactca
caacaacatttagaagttcaattgaaggagtcctggtacgaaaaattgcaccgttgggat
gaggccttgaaggcatacaaagcaaagtcatctcaagcatctgggccattacaaaacttg
gatgctacattaggtcgaatgaggtgtctagcagccttggcccgttgggaagatttaagt
gcattatgcagggagcaatggactggctcagaaccatctgcccgactagaaatggctccg
atggctgccaatgctgcttggcatatgggtgagtgggaccacatggctgaatatgtttct
cgtctggatgatggggatgaaaacaagctccggatattgggtaacacaacagctagtggt
gacggaagcagcaatggtgctttctttagggctgttctttcagttcgttgcaaaaagtat
gaagaagctcgtgtatatgttgagagagctcggcggtgtttggctacagaacttgcagca
ttggtacttgagagttatgagcgtgcttataataatatggtgcgggttcaacagctttct
gagctggaagaggtgattgattactgcactcttccaatggaaagtccaatagctgacagc
cggagggaacttatccgtaatatgtggaatgagcgtattaaaggaacaaaacggaatgtt
gaggtgtggcaagccttacttgctgttagagagttggttctccctcctaatgaagacaga
gacacctggataaaatttgccaaactttgctggaagagtggccgcattagtcaggctaaa
tctaccttagtcaaactcttacagtttgatccagaatcttcccctgaattgacgctgtat
catggacatcctcaagtagtcctggcatacctgaagtaccagtatgctgttggagatgag
cttaaacgaagggacgcgttttgcaggctacaggatttgtctgtgcagcttgctaccgca
acaaatagttattctggaacattagcaagccaggttgccacatcaaatgctggagtacca
cttattgctcgcgtctatttgacacttgctagctggaagagagcattatcacctgggtta
gacgatgattctattcaagaaatattggtctcttacaaaaatgccacacttaatgccaag
gactggggcaaggcatggcacttatgggccttgttcaacactgaagtcatgtcccgctat
actttgcgtggtcgaccagatattgcaggaaaatatgttgttgcagcagtaactgggtat
ttctactctattgcttgcgcatccacgacaaaaggtgttgatgatagcttacaggatatc
cttcgtctcttgactctttggtttaatcatggggctacctcagaggttcaaatggcactg
cagaaaggcttttcacttgtcaatatagaaatgtggttggttgtccttccccagataatt
gcaaggatccattcaaataataaaatagtgagagaactgatacagtcattgctggttcga
attggaaaggatcatccacaggcattgatgtatcctctgttggttgcttgcaaatcaata
agcatattaagacaacgagcggcgcaagaggtcgtcgataagatccgccaacatagtgga
ggtcttgttgatcaggcacagcttgtttcaaaggaactgatacgagttgccattctgtgg
catgagatgtggcatgaggctcttgaggaagctagcaggatgtattttggtgagcacaat
attgagggaatgcttgcagtgcttgaaccattgcatgcaatgctcgagaggggtcctgag
acaataaaagaaaatactttcattcaggcttatggtcatgaattactggaagcccacgaa
tgctgtttaaaatatcgggctacaggagaggatgctgagttaactaaggcatgggatttg
tattaccatgttttcagaagaatagacaaacagcttccaagtcttacaactttggatttg
cactctgtgtcacccgagcttcttgagtgtcgaaagttggagcttgctgtaccaggaact
tattctgcagatgcaccacttgtgacaattgagtattttgttcctcaattgattgttata
acatctaaacaaagaccaagaaaactgacaattcatggaagtgatggcaacgattatgca
ttcttgctgaaaggccatgaagatttacggcaggatgagcgtgtaatgcagctttttggc
ctggtgaatactctgctggagaactctaggaaaacttcagagaaagatctgtcaatccaa
agatatgctgtcatacctttgtctcctaacagtggtttaattggatgggttccaaattgt
gacacacttcatgccctgatccgtgaatatagagatgccaggaagattttcttaaatcag
gagcaccgatgtatgttgagttttgcacctgattatgaccacttacccctcatcgccaaa
gtagaagtatttcagcatgccctagaaaacagtgaaggaaatgaccttgcaaaggttctc
tggcttaaaagccgaacctctgaagtatggcttgagcggcgcacaaattatacgagaagt
ctggctgttatgagcatggttggctatttgcttggtttaggagatcggcatccaagtaat
cttatgttagatcgttatagtggaaaaatattacatattgactttggcgattgctttgag
gcttcaatgaatcgtgaaaagtttcccgaaaaggttccatttcgcttgactagaatgctt
gtgaaagccatggaagttagtggtattgagggtaccttcagaaccacttgcgaaaatgtg
atgcaagtacttcgaacaaacaaggatagcgttatggctatgatggaggcatttgtgcat
gacccattaatcaattggcgtctgttcaatttcaatgaagtccctcaagttacaaactat
ggaaatgctcacagtcacacagttgtcaatagcgaagaagctgctaatcgggagctcatg
caaccaccccggggagctcgggagagagaactgctacaggcggtcaatcaactcggtgat
gctaacgaggttttgaatgagcgtgccgtagctgtgatggcacgaatgagtcataagctc
acagggcgcgatttctcttccggatcatcgttgtcgggggcgggaagctccacccaacat
ggtaacgagcatctggcttcaggagacactcgagaggtggaacctggtttatccgtgaag
gttcaggttcagaggcttatacttcaagcgacttcgcatgaaaacttgtgccaaaactac
gtcgggtggtgcccgttttggtga

DBGET integrated database retrieval system