KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0415700-01Help
Entry
Os05t0415700-01   CDS       T02163                                 

Gene name
Os05g0415700
Definition
Glycoside hydrolase, family 20 protein.
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os05t0415700-01 (Os05g0415700)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Os05t0415700-01 (Os05g0415700)
   00603 Glycosphingolipid biosynthesis - globo series
    Os05t0415700-01 (Os05g0415700)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Os05t0415700-01 (Os05g0415700)
   00511 Other glycan degradation
    Os05t0415700-01 (Os05g0415700)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Os05t0415700-01 (Os05g0415700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(20315720..20316046,20316128..20316202,20316406..20316441,20316548..20316659,20317328..20317398,20317533..20317663,20317964..20318029,20318249..20318349,20318557..20318616,20318709..20318742,20319098..20319196,20319265..20319324,20319946..20320196,20320319..20320491)
AA seq 531 aa AA seqDB search
MAPAMALRLLVVVAVAAVVSCAVAADEGSVVEVWPMPATASKGGQTLHVSRELRMTAEGS
KYADGEAILKDAFQRMVTLIELDHVINGSSQGLPLLAGVNVVVHLPGDELNFGVDESYNL
SVPATGSPIYAQIEAQTVFGALHALETFSQLCNFDFTSRLIELQSAPWSITDMPRFPYRG
LLIDTSRHYLPVPVIKSVIDSMTYSKLNVLHWHIVDEQSFPIEIPSYPKLWNGAYSYSER
YTMDDAIDIVQYAERRGVNVLAEIDVPGHALSWGVGYPSLWPSATCKEPLDVSSESTFQV
INGILSDFSKVFKFKFVHLGGDEVNTSCWTSTPRVKAWLAQHGMKESDAYRYFVLRAQKI
AKSHGYEVINWEETFNNFGDKLDRRTVVHNWLGGGVAEKVVAAGLRCIVSNQDKWYLDHL
EVTWDGFYMNEPLRNIKNPAQQKLVLGGEVCMWAEHIDASDIQQTIWPRAAAAAERLWTP
FEKLSKEWEIAALSARLARFRCLLNHRGIAAGPVTGYGRSAPAEPSSCIKQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgccagcgatggctctgaggttgctggtggtggtggcggtggcggcggtggtgtcc
tgcgccgtcgccgccgatgaggggagcgtcgtcgaggtgtggccaatgccggcgacggcg
agcaaaggcgggcagacgctgcacgtcagcagggagctcaggatgacggcggaggggagc
aagtacgccgacggggaggccatcctgaaggacgcgttccagaggatggtgacgctgata
gagctggaccacgtcatcaatggcagctcccagggcttgccgctgctcgccggtgtgaat
gtcgtcgtgcatttgcccggcgatgagctcaacttcggggtggatgaatcatacaatttg
tcagtgcctgcaactggaagtccaatttatgctcaaattgaggcccaaacagtttttgga
gcacttcatgccttggagacgtttagccaattgtgtaactttgatttcacctcaaggtta
attgaacttcagtctgccccttggagcatcacggacatgcccagatttccttatcgaggg
cttcttattgatacttcaaggcattaccttcctgtcccagtaataaaaagcgtaatcgat
tcgatgacctacagcaagttgaatgttcttcattggcatatcgtggatgaacagtcattt
cctatagaaataccttcatacccaaaattatggaatggtgcatactcttactcagagaga
tatacaatggatgatgctatcgacattgttcagtatgctgaacgacgaggtgtcaatgtc
ttagctgagattgatgttcctggccatgctctctcatggggtgttggttatccgtcgttg
tggccatcagctacttgtaaagaaccacttgatgtcagcagcgaatctacattccaagtg
attaatggaattctttcagatttcagcaaggtttttaagttcaagtttgtccatttggga
ggtgatgaggtcaatacaagttgctggacttccacaccacgcgttaaagcatggttggcc
caacatggtatgaaagaatctgatgcctacagatattttgtattgagagctcaaaagata
gcaaaatcacatggctacgaagttattaactgggaagaaacctttaacaactttggagac
aaactagaccgcagaactgtggtgcataactggcttggaggtggagttgcagagaaagtt
gttgctgctggtttgagatgcattgtgagcaaccaggataagtggtacctagatcacttg
gaagttacatgggatggattttatatgaatgaaccactgagaaatatcaagaacccggca
cagcagaagttggttcttggtggtgaggtatgcatgtgggctgaacacatagatgcgtct
gacattcagcaaaccatttggccacgtgctgcagcagctgcagagcggttgtggactccg
tttgagaagctttcaaaggagtgggaaatagcagcgctcagcgcaagactggcacgcttc
aggtgcttgctgaatcatagagggatcgctgctggaccggtaactggttatggacgttcc
gcgccagcagagccaagctcctgtataaagcagtag

DBGET integrated database retrieval system