KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0420600-01Help
Entry
Os05t0420600-01   CDS       T02163                                 

Gene name
Os05g0420600, CC1, CYTOCHROME_C_1
Definition
(RAP-DB) Cytochrome c.
  KO
K08738  cytochrome c
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
RAP-DB: Os05t0420600-01
Oryzabase: 6107
Structure
PDB: 

Jmol
Position
chr05:join(20630130..20630241,20631064..20631197,20631914..20632006)
AA seq 112 aa AA seqDB search
MASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttctcggaggctcccccgggcaaccccaaggccggcgagaagatcttcaag
accaagtgcgcccagtgccacaccgtcgacaagggcgccggccacaagcaaggtccaaac
ttgaatggtctgtttggaaggcagtcaggtaccacccctggttattcctactctacggcc
aacaagaacatggctgtgatctgggaggagaacacactttatgactacctgcttaatcct
aagaagtacatccctggaaccaagatggtcttccctgggttgaagaagccacaggagcgt
gctgatcttatttcctacctgaaggaagcaacctcttaa

DBGET integrated database retrieval system