KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0420600-01Help
Entry
Os05t0420600-01   CDS       T02163                                 

Gene name
Os05g0420600, CC1, CYTOCHROME_C_1
Definition
Cytochrome c.
Orthology
K08738  
cytochrome c
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Os05t0420600-01 (Os05g0420600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Structure
PDB: 

Jmol
Position
chr05:join(20630130..20630241,20631064..20631197,20631914..20632006)
AA seq 112 aa AA seqDB search
MASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttctcggaggctcccccgggcaaccccaaggccggcgagaagatcttcaag
accaagtgcgcccagtgccacaccgtcgacaagggcgccggccacaagcaaggtccaaac
ttgaatggtctgtttggaaggcagtcaggtaccacccctggttattcctactctacggcc
aacaagaacatggctgtgatctgggaggagaacacactttatgactacctgcttaatcct
aagaagtacatccctggaaccaagatggtcttccctgggttgaagaagccacaggagcgt
gctgatcttatttcctacctgaaggaagcaacctcttaa

DBGET integrated database retrieval system