KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0488900-01Help
Entry
Os05t0488900-01   CDS       T02163                                 

Gene name
Os05g0488900
Definition
Similar to Cytochrome b5 reductase.
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dosa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(24027889..24028009,24028264..24028405,24028501..24028591,24028746..24028823,24028955..24029035,24029125..24029214,24029849..24029914,24030092..24030178,24030318..24030410)
AA seq 282 aa AA seqDB search
MEFLQGQSTETAVAVAVAVVAVAAGAAFLLLLLRSSKKPKGCLDPENFKEFKLVEKRQIS
HNVAKFRFALPTPASVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGRFELVIKMY
PQGRMSHHFHEMKVGDYLSVRGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVTRAILENP
SDNTKVHLIYANVTYDDILLKEELDSMVETYPDRFKIYYVLNQPPEIWNGGVGFVSMEMI
QTHCPAPAADIQILRCGPPPMNKAMAEHLENLGYTKEMQFQF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcaggggcagagcacggagaccgccgtggccgtggcggtggccgtcgtc
gccgtggccgccggcgccgccttcctcctcctcctcctccgcagcagcaagaagcccaag
ggctgcttggaccctgagaacttcaaggagtttaagcttgtggagaagaggcagatcagt
cataatgtggccaagttcagatttgctctaccaacccctgcttctgtgctggggcttcca
attggccaacatatcagttgcagagggcaggatgctactggcgaggaagtaatcaagcct
tatactccaactacgctggattctgatcttggacggtttgagcttgttattaagatgtat
ccccaaggaagaatgtctcatcattttcatgagatgaaagttggtgactatttatctgtg
agaggacctaagggtcgcttcaaataccaacctgggcaagtaagagcatttggaatgtta
gctggaggatcaggcattaccccaatgttccaagtcacaagagcaattcttgaaaaccca
agtgacaatacgaaagtgcacttaatctatgccaatgtcacatatgatgacattcttcta
aaggaagaattggatagtatggttgaaacctatcccgatcgcttcaagatatactatgta
ttaaatcagcctccagaaatctggaatggtggtgttgggtttgtgtcaatggaaatgatc
caaacccattgcccggcacctgctgctgacattcagatattgagatgcggacctcctccc
atgaacaaagccatggctgaacacctggagaatcttggctacacgaaggaaatgcagttc
caattctaa

DBGET integrated database retrieval system