KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0490700-01Help
Entry
Os05t0490700-01   CDS       T02163                                 

Gene name
Os05g0490700
Definition
Similar to SET domain protein SDG111.
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Os05t0490700-01 (Os05g0490700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Os05t0490700-01 (Os05g0490700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:complement(24116877..24118895)
AA seq 672 aa AA seqDB search
MDRASNFIPGPYQELVDAKPIRSLAPMFPAPLGINVNQSSTPPLVCVTPVGQFPVGFGSG
ILPTFGSTTAFTTTANGVSYTSYTNNGAIDATPISAYKTRPGIVSLDGDEPYSGSASGRK
SKRSSGSAADGSNGVKFKRPKPVYKNFVAGKELAFLPPSSSDPREVVEAVHMTFEALRRR
HLQLDEIQETSKRADLKAGAIMMASNIRANVGKRVGLVPGVEIGDIFYFRMELCIIGLHA
PSMGGIDYMSAKFGSDEDSVAICIVAAGGYENVDDDTDTLVYSGSGGNSRNSEERHDQKL
ERGNLALERSLHRKNEIRVVRGFRDPFCLTGKIYIYDGLYKIQESWKERTKSGINCFKYK
LLREPGQPDGAALWKMTQGWIDNPASRGRVILPDLSSAAEALPVCLVNEVDHEKGPGHFT
YASQVKYLRPLSSMKPLQGCGCQSVCLPGDPNCACGQHNGGDLPYSSSGLLACRKPIIYE
CGDACHCTTNCRNRVTQKGVRFHFEVFRTANRGWGLRCWDPIRAGAFICEYTGEVIDELK
VNLDDSEDDYIFQTVCPGEKTLKFNFGPELIGEESTYVSADEFEPLPIKISAKKMGNVSR
FMNHSCSPNVFWQPVQHDHGDDSHPHIMFFALKHIPPMTELTFDYGVAGSESSGSRRTKN
CFCGSSNCRGVF
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggatagggcgtcgaatttcatacctggtccttatcaagaactcgtggatgccaaacca
attagatcgttagctcctatgttccctgcacccttgggaatcaatgtcaaccagtcaagc
accccgcctttggtatgtgtcactccggttggccaatttcctgtcggttttggttctgga
atccttcctacctttggttcaactactgccttcactaccacagcaaatggggtttcttat
acaagctacaccaataatggagctattgatgccactcctatctcggcatataagaccaga
ccaggcattgtatcacttgatggcgatgaaccttactcaggttcagcatctggacggaag
tccaagagatcatctggttcagctgctgatggttcaaatggagttaagttcaagcgccct
aagccagtttacaagaattttgttgctggcaaggagcttgcctttttaccaccttcatcc
agtgatcccagggaggttgtggaagcagtccacatgacctttgaagcacttaggcgtaga
catctgcaactggatgaaatacaagagactagcaaacgggctgacctgaaggctggcgcc
atcatgatggcaagcaatatcagggctaatgtgggaaaaagggtaggacttgttcctgga
gttgaaataggggatattttctatttccggatggagctatgtatcatcgggttgcatgct
cctagtatgggtggcattgattatatgagtgctaaatttggaagcgatgaggattctgtg
gcaatatgtattgttgcagcaggtggctatgagaatgtggatgatgacacagatacactg
gtgtacagtggttcaggtggcaatagtaggaacagtgaggagaggcatgatcaaaagctt
gagagaggtaaccttgctctggagaggagcctgcataggaagaacgagatcagggttgtg
cggggcttcagggatccattttgcctgactggaaaaatctacatatatgatggcctctat
aagattcaggagtcctggaaggagagaacaaagtctggtatcaattgcttcaagtacaaa
ctgctgcgtgagcctggacagcctgatggagctgcattgtggaagatgactcaaggatgg
atagacaatccagcaagcagaggcagggttatattacctgatctatcatctgcggctgaa
gctctcccagtttgccttgtcaatgaggtagaccatgagaaaggacctgggcatttcacc
tatgccagtcaagtcaaatacttgaggcccctcagttctatgaaacccttacagggttgc
ggatgccagagtgtttgcctgcctggtgatcccaactgtgcttgtggacaacataacgga
ggtgacttaccttacagctcatcaggacttttggcgtgccgcaagccaataatttatgaa
tgcggtgatgcttgccattgtactacgaattgccggaacagagtgacccaaaaaggggtc
agatttcactttgaggtcttccggactgcaaatcgaggctggggtcttcgctgctgggat
cccattcgtgctggtgcatttatctgtgagtatactggtgaggtcattgatgagctcaaa
gttaatctggatgacagtgaagatgattacatttttcagactgtatgtcctggtgagaag
acattaaaattcaactttggtcctgaattgattggtgaggagagtacatatgtatcagct
gatgaatttgagccactgcccatcaagattagtgcaaaaaagatgggaaatgtctcacgt
ttcatgaaccatagttgttccccgaatgttttctggcagccagttcagcatgaccatgga
gatgacagccacccacatatcatgttctttgcactgaagcacattcctcccatgacagaa
ctgacttttgactatggtgttgctggatctgagtcttcaggttctcgtagaactaagaac
tgcttttgtggatcatcaaactgccggggagtattttaa

DBGET integrated database retrieval system