KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0496100-00Help
Entry
Os05t0496100-00   CDS       T02163                                 

Gene name
Os05g0496100
Definition
Translation initiation factor eIF3 subunit domain containing protein.
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Os05t0496100-00 (Os05g0496100)
Translation factors [BR:dosa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Os05t0496100-00 (Os05g0496100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:complement(join(24377967..24377979,24377460..24377842,24377113..24377367))
AA seq 216 aa AA seqDB search
MASWDDDEFSDEEEQSMGKRLWEDEDAGDDFAAVKDTWDDDDDVKPGKETAATAASTKPP
ATKGKKSQANAKAKAEAADATPSETSTSNAAAEIAQKQPDDDEPIEKFVPKSEKEFAEYA
ERIAKDLLRPYEKSYHYIGLMKAMNKLAVASLTSTSVKEIVSSMTTVANEKLKAEKAADA
GKKKPGQKKKRLHVNKAEGQKFRDADDDDDDDCLSS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgggatgacgatgaattttccgatgaggaagaacagtctatgggaaaaagg
ctttgggaggacgaagacgccggcgacgacttcgccgcggtgaaggacacgtgggacgac
gacgacgacgttaaacctgggaaggagacggccgccacggcggcgagcacgaaacctcct
gcaaccaaagggaagaagagccaggccaacgcgaaggcgaaggcagaagcagcagacgca
acaccgagtgaaacctctacctcgaatgccgctgctgagatagctcagaagcagcctgac
gacgacgaacccatcgagaagttcgtcccaaaatcggagaaggaattcgccgagtacgcc
gagcgcatcgcgaaagatcttcttagaccttacgagaaaagctaccattacattggtctt
atgaaggcgatgaacaagctcgccgtggcgtcgctgacgtcgacgagcgtgaaggagatc
gtgtcgtccatgacgacggtggccaacgagaagctcaaggccgagaaggcggccgacgcc
ggcaagaagaagccagggcagaagaagaagaggcttcacgtcaacaaggccgaagggcaa
aagtttcgtgatgctgacgacgacgacgacgacgattgtctatcatcttaa

DBGET integrated database retrieval system