KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0510300-01Help
Entry
Os05t0510300-01   CDS       T02163                                 

Gene name
Os05g0510300
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os05t0510300-01 (Os05g0510300)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os05t0510300-01 (Os05g0510300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr05:join(25274747..25274924,25275023..25275515,25276679..25276754,25276861..25276953,25277479..25277565,25277650..25278407,25278759..25278887,25279457..25279577)
AA seq 644 aa AA seqDB search
MAPAVQPPPSPPPPRRPRSGPPPGLKNLGNTCYLNSVLQCLASTPPLATFCLSFRHSNLC
KKVLPNKDKECVFCVVERQISRLLRTEAGALDSPAKIIRCLPLFAEHFRWGRQEDAHEFL
RYIIDACHTAGLRIRKRLPASNANGDAGEEEVRVQGPYMVMKETFGGALLSQVKCLTCKG
ESNKTDEIMDISLDLPGSNSVADALARFFQPEILEGSNKYSCERCKKLTSARKQLFVLRA
PKVLVIQLKRFEGINGGKINRNIEFKETLFLSDFMYNKNQDSLPVYNLFGSIVHSGFSPD
SGHYYAYVKDAIGRWYCCNDSHISPSSSQDVLSEKVYILFYILSTKTQKPSTNGYSSSAA
KSSNSNGNGISNATSNEPLKIPLVKQNGLCSSKGIAPPPLKNGKIAPGMHLKPIHLKNNG
TGKVSSNGKASIIPGNKLEVSEGLTLPAVNGRDSGKYAEPGKMNANGSVSCNKTDVNSQR
VLPNTNGNGNPIHFSDLQETIDAKATCAEQYSEKSSIASLEDSKNPVSCHEMSAVIVKDV
VSSGKDSSSLKHHLEEGKFKEMLAESASSELHLSGWVDDVRNFMHTIKRRRLQNTGTPQD
SDTMRKELISESGRIFRSKIPESLREHLIQALRSYYQDKFSLGG
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgccgttcagccgccgccgtccccgcccccgccgcggcggccccgctcgggc
cctccaccggggctgaagaatctcggcaacacctgctacctcaacagcgtgctacagtgc
ctcgcgtcgacccctcccctcgctaccttctgcctctccttccggcactccaatctgtgc
aagaaggtgttgccgaacaaggacaaggagtgtgtgttctgtgtggtggaacggcagatc
tcgcggctgcttcggaccgaagcaggggcgctagactcgccagcgaagatcatacgctgc
ctgccgctctttgccgagcatttccggtggggccgccaagaggatgcgcacgagttcctg
cgctatattatagacgcttgtcacaccgctggtctgcgcatacgcaagcggctacctgcg
tcaaacgccaatggggacgctggcgaggaggaggtccgggtgcaagggccatatatggtg
atgaaggagacatttggcggtgcgctgctcagccaagtgaagtgcctcacctgcaaggga
gagtcaaacaagaccgacgagataatggatatcagcctcgacctgcctggaagcaattct
gttgctgatgcgcttgcccgtttttttcagcctgagatattggagggttcaaacaagtac
agctgcgaaagatgcaagaagctcacctcagcacggaagcaattgtttgtccttagggca
cctaaggtgctcgtcatacaactcaagagatttgagggaataaatggtgggaagatcaac
aggaacatagaattcaaagagactctctttctttctgacttcatgtataataaaaaccag
gattcactgccagtatataatctttttggcagtattgttcactcagggttctctccagat
tctggtcactactatgcgtatgttaaggatgctattggtcgctggtattgttgtaatgat
tcccatatctccccctcaagctctcaggatgttctatctgagaaggtctacatcctattc
tatattctgagtaccaaaactcaaaagcctagtacaaatggttactcttctagtgcagct
aaatcttccaacagcaatggaaatggcatatcaaatgccacatctaatgagcccctgaag
ataccactagtaaaacagaatggactatgttctagtaaaggtattgcaccgccacccctg
aagaatggcaagattgcaccaggtatgcacctcaagccaatccacttgaagaataatgga
acggggaaagtttcttcaaatggcaaggcaagcatcattccgggcaataagctagaagtt
agtgagggtttaacactgccagcagtgaatggccgtgactctggaaaatatgcagaaccc
ggtaaaatgaatgctaatggtagtgtttcttgcaataagacggatgttaattcacagaga
gtgttgcccaatacgaatggaaatggaaatccaattcacttttctgatcttcaagagacc
attgatgctaaggctacatgtgctgagcaatattctgaaaagtcatctattgccagtttg
gaggattctaaaaatcctgtttcatgccatgaaatgtctgcagtcatagtaaaggatgtg
gtatcttcgggtaaggacagttcttccttgaagcaccatcttgaagaagggaagtttaag
gaaatgcttgctgaatcggcatcttctgagcttcacttgtctggttgggtggatgatgtc
cgtaatttcatgcacactataaagagacgccgtctacaaaatacaggcacgcctcaagat
agtgacacaatgagaaaggagctgataagcgaatctggaagaatatttaggtcaaaaatt
ccagaatcgctgagggagcatctcattcaagccctgcggtcatattaccaggacaaattt
tcactgggaggataa

DBGET integrated database retrieval system