KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0521600-01Help
Entry
Os05t0521600-01   CDS       T02163                                 

Gene name
Os05g0521600
Definition
Pectin lyase fold/virulence factor domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os05t0521600-01 (Os05g0521600)
   00500 Starch and sucrose metabolism
    Os05t0521600-01 (Os05g0521600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os05t0521600-01 (Os05g0521600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(25949180..25949595,25949709..25949898,25949980..25950186,25951453..25951688,25951915..25952062)
AA seq 398 aa AA seqDB search
MAVSVSWSWAPRFLACVAVAVLLVTSGLGGAAAGGGGRRHGHTKGLRPGKAAAKPYYPVN
ATAVEAIERQFTRWVRSMVGRRHSTFQRALYRGLLPTRTLVVDKNPAAGNFTSIQAAVDS
IPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGAGADKTVVQWGDTADTVGPLGRPFG
TFASATFAVNAQFFVAKNITFKNTAPVPRPGALGKQGVALRISADNAAFLGCNFLGAQDT
LYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVHAIARNYGALTAQNRMSILEDTGFS
FVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCT
GPGSNYAGRVAWSRELTDQEAKPFISLSFIDGLEWVKL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtccgtgtcgtggtcgtgggcgccgcggttcttggcctgcgtcgcggtggcg
gtgttgcttgttacgtcgggtttgggcggtgcggccgccggcggcggcgggcgacgccat
gggcacacgaaggggttgcggccggggaaggcggcggcgaagccgtactatccggtgaac
gcgacggcggtggaggcgatcgagcggcagttcacgcggtgggtgcggtccatggtcggg
cgacgccacagcacgttccagcgcgcgctctaccgcgggctgctgcccacgcgcaccctc
gtcgtcgacaagaaccccgccgccggcaacttcacgtccatccaggccgccgtcgactcg
atcccgctcatcaacctcgcccgcgtcgtcatcaaggtcaatgccggcacatacactgag
aaggtgaccatctcgccgctccgcgcgttcgtgaccatcgagggcgccggcgcggacaag
acggtggtgcagtggggcgacacggccgacacggtcggcccgctcgggcgccccttcggc
accttcgcctccgccacgttcgccgtcaacgcgcagttcttcgtcgccaagaacatcacc
ttcaagaacacggcgccggtgccgaggccgggggcgctggggaagcagggtgtggcgctg
cggatatcggcggacaacgcggcgttcttggggtgcaacttcctcggcgcgcaggacacg
ctgtacgaccacctcggccgccattactacagagactgctacatcgagggctccgtcgac
ttcatattcggcaacgccctctctctctacgagggatgtcacgtgcacgcgatcgcgcgg
aactacggagccctgacggctcagaaccggatgagcatcctggaggacacgggtttctcg
ttcgtcaactgccgcgtgacgggctccggcgccctctacctcggccgcgcctggggcacc
ttctcccgcgtcgtcttcgcctacacctacatggacaacatcatcatcccccgcggctgg
tacaactggggcgatcccacccgcgagatgacggtgttctacgggcagtacaagtgcacg
gggccgggttcgaactacgccgggagggtggcgtggtcgagggagctcacggaccaggag
gccaagccgttcatctccctcagcttcatcgacgggttggagtgggtcaagttgtag

DBGET integrated database retrieval system