KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0524400-01Help
Entry
Os05t0524400-01   CDS       T02163                                 

Gene name
Os05g0524400
Definition
Phosphofructokinase family protein.
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dosa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dosa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(26107395..26107712,26108356..26108402,26108501..26108540,26108622..26108684,26108770..26108907,26109762..26109920,26110000..26110053,26110213..26110281,26110403..26110532,26110798..26110838,26111022..26111246,26111449..26111494,26111591..26111742,26111911..26112132)
AA seq 567 aa AA seqDB search
MASSHIILPPDDDDEEQRRLEEEEDEDPWARSGPPPAAPEHAMKAALPFSATCVRISRDS
YPNLRALRNASSVSLADAAYVKISEGDFGYVLDDVPHLVDHLPDAPTYPNPLQDHPAYST
VKQYFVNEDDTVPQKVVVQKNSRRGVHFRRAGPRQKVYFESDEVKACIVTCGGLCPGLNT
VIRELVCGLAHMYNVSKIYGIQNGYKGFYSSNYLTLTPKSVDDIHKRGGTVLGTSRGGHD
TKKIVDNIQDRGINQVYIIGGDGTQKGAYEIFKEIRKRGLKVSVAGIPKTIDNDIAIIDK
SFGFDTAVEEAQRAIDSAHVEACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPE
SPFYMDGEGGLLQYVERRLKENKHMVIVVAEGAGQDLIAKSLSTSEQQDASGNKLLLDIG
LWLTHKIKDHFKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYSFT
VGNVNGRHAYIPFYRVTSTRNKVKITDRMWARLLSSTNQPSFLSQKDIDEAKENDRTANK
PPLPTGLSHHVANSFDQSASSSSNSQI
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcccacatcatccttccgccggacgacgacgacgaggagcagcgccggctg
gaggaggaggaggacgaggatccgtgggcgcggagcgggcctccccccgcggcgccggag
cacgcgatgaaggcggcgctgccgttctccgcgacgtgcgtgcggatctcccgcgactcc
taccccaacctccgcgccctccgcaacgcctcctccgtcagcctcgccgacgccgcctac
gtgaagatctccgagggggacttcggctacgtcctcgacgacgtgccgcacctcgtcgac
cacctccccgatgcccccacttatcccaatccactacaagatcatccagcctattcaact
gtcaagcaatattttgttaatgaagatgacactgtaccccaaaaggtggtcgttcagaag
aacagccggcggggggttcacttccgtcgtgctggacctcgtcagaaggtttattttgag
tcagatgaagtgaaagcatgcattgtaacttgtggaggcctttgccctggtcttaacact
gtcatcagagagctcgtctgtggtttggcgcacatgtataatgtcagcaaaatctatggt
atacagaatggatacaagggcttctattctagcaattaccttactctgacgccaaagagt
gtcgatgacatccacaagaggggtgggacagttcttggcacatcacgaggtggccatgat
acaaaaaagattgttgacaacattcaggatcgtggaattaatcaggtctatatcattgga
ggagatggaacacagaagggtgcatatgagatcttcaaggaaatccgaaaacgtgggcta
aaggtttctgttgctgggattcccaagacaatagataatgacatagcgatcattgacaag
tcatttggttttgatacggccgtagaagaggcccagcgtgccattgattcagctcatgtg
gaagcttgcagtgctgagaatggaataggcttagtaaaactgatgggccgttatagtggg
ttcattgcaatgtatgctactcttgcaagtcgagatgtggactgctgcttaattccagag
tccccattttatatggatggtgaaggtgggttgcttcaatatgtagagagaaggctgaaa
gagaacaagcacatggttattgttgttgctgagggagcagggcaggatcttatagccaaa
agtttatctacttctgagcagcaagatgcatcaggaaataagctactgcttgatattggt
ctttggctgactcacaagataaaggaccacttcaagagcaaaaagatggagatgactatt
aaatatatagatcctacctacatgatccgagctattccaagcaatgcatcagacaatgtc
tactgcacgctgctggcccacagtgctattcatggtgcaatggccggctatagcttcact
gttggaaatgtcaacggcagacatgcctacatacctttctatagggtgacatccacacgg
aacaaggtcaagatcactgataggatgtgggcgaggctgctatcatcaaccaaccagcca
agcttcctaagccagaaggacatcgacgaagccaaagagaacgataggacggccaacaag
ccaccacttcccaccggcctcagccatcatgtggcaaactctttcgaccagtctgcatca
tcttcgtcgaacagccagatatga

DBGET integrated database retrieval system