KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0535400-00Help
Entry
Os05t0535400-00   CDS       T02163                                 

Gene name
Os05g0535400
Definition
Choline/ethanolamine kinase family protein.
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Os05t0535400-00 (Os05g0535400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Os05t0535400-00 (Os05g0535400)
    2.7.1.82  ethanolamine kinase
     Os05t0535400-00 (Os05g0535400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:join(26584625..26584990,26586574..26586695,26586814..26587009,26587431..26587548,26587658..26587705,26587784..26587884,26587967..26588074)
AA seq 352 aa AA seqDB search
MVASETNQKAAAAGSSIPEGARQLLHELAAGWGDVADCRALEVVPLRGAMTNEVYQARWP
PAAEAEAAGRRVLVRVYGEGVELFFDREAEVRTFESMSRHGHGPRLLGRFPNGRVEEFIH
ARTLSAVDLRDPEISAIIASKLREFHNLDMPGPKSVLIWDRLRNWLKTAKNLCPSDEAKE
FCLDSMENEITALENELSEDYQCVGFCHNDLQYGNIMIDEETKLLTIIDYEYASFGPVAY
DIANHFCEMAADYHSEKPHILDYTKYPDTDEQKQFVQSYLSSSGEEPDAEKVNNLIKSIE
KYTLASHLIWALWGIISEHVNDIDFDYMGYARQRFEQYWLKKPAILTCQVVE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgagcgagacgaaccagaaggcggcggcggcggggagcagcatcccggagggg
gcgcggcagctgctgcacgagctggcggcggggtggggcgacgtggcggactgccgggcg
ctggaggtggtgccgctcaggggggccatgaccaacgaggtctaccaggcgcggtggccg
ccggcggcggaggcggaggcggcggggaggagggtgctggtgagggtgtacggcgagggc
gtggagttgttcttcgaccgggaggccgaggtgcgcacgttcgagtccatgtcgcggcac
ggccacggcccgcgcctcctcggtcgcttccccaacggccgcgtcgaggagttcatccac
gccaggacactctcagctgttgatctgcgtgatccagagatttcagccattatagcctca
aagctgagggaattccacaaccttgatatgcctggtccaaaatctgtactcatttgggac
agactaaggaactggctcaaaactgccaagaatttgtgcccctctgacgaagccaaagag
ttctgcttggatagcatggagaacgagatcactgcgttggaaaatgagctttcagaggat
taccagtgcgtaggattttgccacaacgatctccagtatggaaacatcatgattgatgaa
gagaccaaattgctgaccatcattgactatgagtatgcaagttttggtccagttgcttat
gacattgcaaaccatttctgcgagatggctgcagactaccattcagaaaagcctcacata
ctggactacactaaatatccagatactgatgagcagaagcaatttgtgcagagctacctg
agctcttcaggcgaggaacctgacgcagagaaggtcaataatctgataaaaagtatcgag
aagtacaccttggcaagccatctcatttgggccctctggggaataatttcggagcatgtc
aacgatattgacttcgactacatggggtatgcgaggcagaggttcgagcagtactggctc
aagaagcctgcaatcctaacatgtcaggtcgttgaataa

DBGET integrated database retrieval system