KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0539400-01Help
Entry
Os05t0539400-01   CDS       T02163                                 

Gene name
Os05g0539400, BGAL9, BETA-GALACTOSIDASE_9
Definition
Glycoside hydrolase, family 35 protein.
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Os05t0539400-01 (Os05g0539400)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Os05t0539400-01 (Os05g0539400)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Os05t0539400-01 (Os05g0539400)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Os05t0539400-01 (Os05g0539400)
   00511 Other glycan degradation
    Os05t0539400-01 (Os05g0539400)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Os05t0539400-01 (Os05g0539400)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os05t0539400-01 (Os05g0539400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr05:complement(join(26801007..26801081,26800765..26800878,26800112..26800307,26799530..26799618,26799342..26799422,26799121..26799215,26798543..26798613,26798157..26798247,26797945..26798062,26797769..26797864,26797629..26797677,26797347..26797537,26797182..26797253,26796955..26797101,26796255..26796305,26795972..26796164,26795242..26795387,26795081..26795146,26794690..26794770))
AA seq 673 aa AA seqDB search
MGPSRSFQNLLLLLLPLALALCSAAASGEASRRFWVENDTFWKDGAPFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPKPLSWEFKGFTDIESYLRLAHELDMLVML
RVGPYICGEWDLGGFPPWLLTIEPTIELRSSDSTYLSLVDRWWGVLLPKIAPLLYSNGGP
IIMVQIENEFGSFGDDKNYLHYLVEVARRYLGNDIMLYTTDGGAIGNLKNGTILQDDVFA
AVDFDTGSNPWPIFQLQKEYNLPGKSAPLSSEFYTGWLTHWGERIATTDASSTAKALKRI
LCRNGSAVLYMAHGGTNFGFYNGANTGQNESDYKADLTSYDYDAPIREYGDVHNAKYKAL
RRVIHECTGIPLLQLPSKIERASYGLVEVQKVASLFDVIHNISDALKVAFSEQPLSMELM
GQMFGFLLYTSEYQEKHSSSILSIPKVHDRAQVFVSCSHGDVRKPRYVGIVERWSSKTLQ
IPSLSCSSNVSLYILVENMGRVNYGPYIFDQKGILSSVEIDGIILRHWKMHPVSLNAVGN
LSKLQLIMQMTDAEASKVSIYGDSENKLQDVSLYLNEGISEEPAFYEGHFHIDSESEKKD
TFISFRGWNKGVAFVNNFNIGRFWPAIGPQCALYVPAPILKPGDNVIVIFELHSPNPELT
IKLVKDPDFTCGQ
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggggccgtccagaagcttccagaaccttcttctcctcctcctccccctcgcgctggcc
ctgtgctccgccgcggccagcggggaggcttcgagaaggttctgggtcgagaacgacacc
ttctggaaggatggcgccccgttccagatcgtcggcggcgacgttcactacttccgcatt
gtccctgagtactggaaagatcgccttttaagggcaaaggcgctgggcttgaacacaatt
cagacatatgttccttggaatctgcatgagccaaaaccgctgagctgggaattcaagggt
ttcacagatattgaatcatatttaagacttgctcatgaattagatatgctggtcatgctt
cgtgtaggtccatatatttgtggagaatgggacttggggggatttccaccttggttactg
accatagaaccaaccatcgaactgcgttcttcagattcaacctatctttccttggtggac
agatggtggggagtactactcccaaaaatcgcaccactattatacagcaatggaggtcct
atcatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattatctt
cattaccttgttgaagttgccagaagatatcttgggaatgacattatgctgtatacaact
gatggtggtgccattggaaatctaaagaatggaacaattcttcaggatgatgttttcgct
gctgttgattttgatactggttccaatccatggccaatatttcaactacagaaggaatac
aacttgccaggaaaatcagctcctttaagctcagaattttacactggatggctaacacac
tggggggaaagaattgcaacaactgatgctagcagtacagctaaagctcttaaaagaatt
ttgtgccgcaacggttctgctgtactttatatggctcatggtgggactaattttgggttt
tacaatggtgcaaatactggtcaaaatgaatctgactacaaggcagacctcacttcatat
gactatgatgcaccaattagggagtatggggacgtgcataatgcaaaatacaaagcacta
agaagagttatacatgaatgcactggcattcctcttctccaacttccttccaaaattgaa
agagctagttatgggcttgtagaagtacagaaggtcgcttctttgtttgatgtcattcat
aacatcagtgatgctctgaaagtggctttttcagagcagcctctatccatggaactgatg
ggccagatgtttggttttctactgtacacatcagaatatcaagaaaaacattcatccagc
atcctatcaattccaaaggtacatgacagagctcaagtgtttgtgtcctgctcacacggt
gatgtcagaaaaccgagatatgttggcatagttgaaagatggtcgagtaaaacactacaa
ataccaagcttaagctgctcatctaatgtcagcttatatatcctggtagaaaacatgggt
cgagtaaattatggaccatatatttttgaccagaagggcatactatcttctgttgaaata
gatggcattattctccgtcactggaaaatgcatccggtttcacttaatgcggtgggcaac
ctttcaaaacttcaactaatcatgcagatgactgatgctgaagctagcaaagtatccatt
tatggtgattcagaaaataagttgcaggatgtatcgctctatctaaatgaagggatttca
gaggaaccggcattctatgaaggccattttcatattgactctgaatctgagaaaaaggac
acattcatatcatttcgaggttggaataaaggagtcgcttttgtgaacaacttcaacatt
ggaaggttctggccggccattggaccacaatgcgctctgtatgttcctgcgccgatcctc
aaacctggagataatgtcattgtgatctttgaactgcatagtccaaaccctgagctcacc
atcaagttagtgaaggatccagatttcacatgcggccagtga

DBGET integrated database retrieval system