KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0549700-01Help
Entry
Os05t0549700-01   CDS       T02163                                 

Gene name
Os05g0549700
Definition
Similar to Threonine synthase, chloroplast precursor (EC 4.2.3.1) (TS).
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dosa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dosa00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr05:27290656..27292221
AA seq 521 aa AA seqDB search
MAATTHAASLSFLLSHPHPTSPNPNPNPNLPLRRAPHRVRCATDAAATRHRRAADENIRE
EAARHRAPNHNFSAWYAPFPPAPNGDPDERYSLDEIVYRSSSGGLLDVRHDMDALARFPG
SYWRDLFDSRVGRTTWPFGSGVWSKKEFVLPEIDPDHIVSLFEGNSNLFWAERLGRDHLA
GMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSAALSAY
CAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIYLANS
LNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDRVPRL
VCAQAANANPLYRYYKSGWTEFTPQVAEPTFASAIQIGDPVSVDRAVVALKATDGIVEEA
TEEELMNAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKFSQSK
IDYHDSKIEDMACKYANPPVSVKADFGAVMDVLKKRLKGKL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccacccacgccgcctccctctccttcctcctctctcacccccaccccacc
tcccccaaccctaaccctaaccctaacctccccctccgccgcgccccccaccgcgtccgc
tgcgccaccgacgccgccgccaccaggcaccggcgcgcggccgacgagaacatccgggag
gaggcggcgaggcaccgcgccccgaaccacaacttctccgcgtggtacgcgcccttcccg
cccgcccccaacggcgaccccgacgagcgctactccctggacgagatcgtctaccgctcc
agctcgggcggcctcctcgacgtgcgccacgacatggacgcgctcgcccgcttcccgggc
tcctactggcgcgacctcttcgactcccgcgtcggccgcaccacctggcccttcggctcc
ggcgtctggtccaagaaggagttcgtcctccccgagatcgaccccgaccacatcgtctcc
ctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgcgaccacctcgcc
gggatgaacgacctctgggtcaagcactgcggcatctcccacaccggatcgttcaaggat
ctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcgccgctctcccgc
cccatcgccggagtcgggtgcgcctccacgggggacacctccgccgcgctctcggcctac
tgcgccgccgcggggatcccggccattgtgttcctccccgccaaccgcatctcgctcgag
cagctcatccagcccattgccaatggcgccaccgtgctctcgctcgacacggacttcgac
ggctgcatgcggctcatcagggaggtgactgccgagctgccgatttaccttgcgaattca
ttgaattcccttcggctcgaggggcagaagactgctgctattgagattcttcagcagttc
gattgggaggtgccggattgggtcattgttcccggaggcaatcttgggaacatatatgcc
ttctacaagggattcgagatgtgccgcgtccttgggctcgtcgatcgtgtgccgcggctt
gtctgcgcgcaggctgccaatgcgaacccgctgtaccggtactacaagtcggggtggact
gagttcacgccgcaggtggctgagccgacatttgcatcggcaattcagattggtgacccg
gtatctgtcgatcgcgcggtggttgcgctcaaggcaactgatggcatcgtcgaggaggcc
acggaggaggaactcatgaacgcaatgtcgctcgctgatcgcactggcatgtttgcttgc
ccgcatactggggttgccctcgcagcactgttcaagctccgtgaccagcgcatcatcggg
ccaaatgaccgcacggtagtcgtcagcacagctcatggtctgaagttctcacagtccaag
atcgactaccatgacagcaagatcgaagacatggcctgcaagtatgcgaatcccccggtc
agcgtgaaggctgacttcggtgccgtcatggatgtcctcaagaagaggctcaagggtaag
ctctga

DBGET integrated database retrieval system