KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0574300-00Help
Entry
Os05t0574300-00   CDS       T02163                                 

Gene name
Os05g0574300
Definition
Similar to Histone H2B.2.
Orthology
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:28612033..28612491
AA seq 152 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAPAAGKKPKAEKRLPAGKGEKGGAGEGKKAGRKKGKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccccggcggcggggaagaagcccaaggcggagaagcggctccccgcgggg
aagggcgagaagggcggcgccggcgaggggaagaaggccgggaggaagaaggggaagaag
agcgtggagacctacaagatctacatcttcaaggttctcaagcaggtccaccccgacatc
ggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaag
ctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcccgc
gagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtctcc
gagggcaccaaggccgtcaccaagttcacctccgcttag

DBGET integrated database retrieval system