KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0574300-00Help
Entry
Os05t0574300-00   CDS       T02163                                 

Gene name
Os05g0574300
Definition
Similar to Histone H2B.2.
Orthology
K11252  
histone H2B
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os05t0574300-00 (Os05g0574300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr05:28612033..28612491
AA seq 152 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAPAAGKKPKAEKRLPAGKGEKGGAGEGKKAGRKKGKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccccggcggcggggaagaagcccaaggcggagaagcggctccccgcgggg
aagggcgagaagggcggcgccggcgaggggaagaaggccgggaggaagaaggggaagaag
agcgtggagacctacaagatctacatcttcaaggttctcaagcaggtccaccccgacatc
ggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaag
ctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcccgc
gagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtctcc
gagggcaccaaggccgtcaccaagttcacctccgcttag

DBGET integrated database retrieval system