KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0147800-01Help
Entry
Os06t0147800-01   CDS       T02163                                 

Gene name
Os06g0147800, MITOGEN-ACTIVATED_PROTEIN_KINASE_KINASE_1, MKK1
Definition
Similar to Mitogen-activated protein kinase kinase 2.
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Os06t0147800-01 (Os06g0147800)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Os06t0147800-01 (Os06g0147800)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Os06t0147800-01 (Os06g0147800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr06:complement(join(2502718..2502776,2502490..2502574,2501690..2501827,2501267..2501492,2500978..2501159,2500667..2500872,2499567..2499612,2499371..2499464,2499218..2499240))
AA seq 352 aa AA seqDB search
MGKPGKLALPSHESTIGKFLTQSGTFKDGDLLVNKDGLRIVSQSEEGEAPPIEPLDHNQL
SLDDLDAIKVIGKGSSGIVQLVRHKWTGQFFALKVIQLNIQENIRRQIAQELKISLSTQC
QYVVACCQCFYVNGVISIVLEYMDSGSLSDFLKTVKTIPEPYLAAICKQVLKGLMYLHHE
KHIIHRDLKPSNILINHMGEVKISDFGVSAIIASSSAQRDTFTGTYNYMAPERISGQKHG
YMSDIWSLGLVMLELATGEFPYPPRESFYELLEAVVDHPPPSAPSDQFSEEFCSFVSACI
QKNASDRSSAQILLNHPFLSMYDDLNIDLASYFTTDGSPLATFNTSNRYDDR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccggggaagctagcgctgccctcgcacgagtcaaccatcggcaaattcctg
acgcagagcgggacgttcaaggacggcgatctgctcgtcaacaaggacggcctccgcatc
gtctcgcagagcgaggaaggggaggcccctcctatagaacctttagatcataatcagttg
agtctagatgatctagacgcaatcaaagttatcggtaaaggtagtagtggaatcgtgcag
ttggttcgccacaaatggactggccagttttttgctctgaaggtaatacaactcaatatc
caggagaatatacgcagacagattgcgcaggaattgaaaatcagcttgtcaacacagtgc
caatatgttgttgcatgctgtcagtgtttttacgttaatggtgtcatttcaattgttttg
gagtatatggacagtggctctctctcagatttcctgaagacagttaaaaccattccagag
ccctaccttgctgcaatctgtaagcaggtgctaaaaggactgatgtacttacatcatgag
aagcacatcatacaccgagatctgaagccgtcaaatatattaataaatcatatgggtgaa
gtaaaaatatccgactttggtgttagtgccatcattgctagttcctcggcacaacgagat
acatttactgggacatataactacatggcgccagaaagaatcagtgggcaaaaacatggt
tatatgagtgatatctggagcttgggcctcgttatgctagaattggccactggtgaattt
ccatatcctcctcgtgaaagcttttatgaactccttgaagctgttgtcgaccacccacca
ccttctgctccatcagaccagttttcagaggaattctgttcattcgtctctgcatgtatc
caaaagaatgcttcggataggtcatctgcacaaatcttattaaatcatccattcctgagc
atgtatgacgacctgaatatagatcttgcttcgtacttcacaaccgatggatctccgctt
gccaccttcaatacaagcaaccgatatgatgacagatag

DBGET integrated database retrieval system