KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0152100-01Help
Entry
Os06t0152100-01   CDS       T02163                                 

Gene name
Os06g0152100
Definition
Similar to Profilin-2.
Orthology
K05759  
profilin
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Exosome [BR:dosa04147]
 Exosomal proteins
  Proteins found in most exosomes
   Os06t0152100-01 (Os06g0152100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr06:join(2690325..2690447,2691605..2691742,2692624..2692758)
AA seq 131 aa AA seqDB search
MSWQAYVDDHLMCEIDGNHLTAAAIVGHDGSVWAQSPNFPQYKPEEITGIMKDFDEPGSL
APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGICVKKTGLSLILGIYDEPMTPGQCNMIVE
RLGDYLIEQGC
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgtcgacgaccacctgatgtgcgagattgacggcaaccacctc
accgccgccgccatcgtcggccacgacggcagcgtctgggcgcagtcccccaacttcccg
cagtacaagcctgaggagattactggcatcatgaaggactttgatgaacccggcagtctc
gcaccaactggtcttttccttgggggcacaaaatacatggtgatccaaggtgaaccaggg
gttgtcatccgaggaaagaagggcactggaggcatatgtgtcaagaagactggcctgtcg
ttgattcttggaatctatgatgagccgatgaccccaggccagtgcaacatgattgtggag
aggcttggcgattatctgatcgagcagggttgctaa

DBGET integrated database retrieval system