KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0154500-01Help
Entry
Os06t0154500-01   CDS       T02163                                 

Gene name
Os06g0154500, MPK1, MAPK6, MITOGEN-ACTIVATED_PROTEIN_KINASE_6, MITOGEN-ACTIVATED_PROTEIN_KINASE_1
Definition
Similar to MAP kinase 5.
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    Os06t0154500-01 (Os06g0154500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Os06t0154500-01 (Os06g0154500)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Os06t0154500-01 (Os06g0154500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr06:complement(join(2812606..2812850,2812389..2812518,2809694..2809831,2808302..2808634,2807790..2807970,2807007..2807176))
AA seq 398 aa AA seqDB search
MDAGAQPPDTEMAEAGGGQQPPAAAAAAGAGAGAGMMENIQATLSHGGRFIQYNIFGNVF
EVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRH
MDHENIVAIRDIIPPPQRNSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRG
LKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLL
NSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENAR
RYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISD
EPVCSSPFSFDFEQHALSEEQMKDLIYQEGLAFNPDYQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacgccggggcgcagccgccggacacggagatggcggaggccggcggcgggcagcag
ccgcctgctgcggctgcggcggcgggggcgggggcaggggcggggatgatggagaacatc
caggcgacgctgagccatggcgggaggttcatccagtacaacatcttcgggaacgtgttc
gaggtcaccgccaagtacaagccccccatcctccccatcggcaagggcgcctacggcatc
gtctgctcggcgctcaactcggagacgggggagcaggtggcgatcaagaagatcgccaac
gcgttcgacaacaagatcgacgccaagcgcacgctcagggagatcaagctgctccgccac
atggaccacgagaatattgttgccataagggatatcatacctcctccacaaaggaattca
ttcaatgacgtttatattgcatatgaattgatggatactgatctgcatcaaattattcgc
tcaaatcaagcattgtcagaggagcactgccagtatttcctttatcagattctccgtggc
ttgaagtatatacattcagcaaatgtccttcaccgagacttgaagcccagcaacctactt
ttgaatgcaaattgtgacctcaaaatttgtgattttggacttgctcgtaccacctcagaa
accgattttatgactgagtatgttgtcacaagatggtatagggcaccggaacttctgttg
aattcctctgaatatactgcagcaattgatgtgtggtctgtgggctgtatttttatggaa
ctcatggatcgtaaacctttgtttcctggaagagatcatgtccatcaattacgtctacta
atggagctcatcggaacgccaaatgaggctgatctggattttgtaaatgaaaatgcaaga
agatacattcgccaacttcctagacatgcaaggcagtcctttcctgaaaaatttccacat
gttcatcctttagcaattgatctggttgaaaagatgctgacatttgatcctagacagaga
ataacagttgaaggtgcccttgcacatccttacctggcatcactgcatgacataagtgat
gagccagtctgctcatcacccttcagctttgacttcgagcagcatgcattgtccgaggaa
caaatgaaggatctaatctaccaagaaggccttgcgttcaaccctgattaccagtag

DBGET integrated database retrieval system