KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0163400-01Help
Entry
Os06t0163400-01   CDS       T02163                                 

Gene name
Os06g0163400
Definition
Thioredoxin domain 2 containing protein.
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Os06t0163400-01 (Os06g0163400)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Os06t0163400-01 (Os06g0163400)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Os06t0163400-01 (Os06g0163400)
  Exosomal proteins of colorectal cancer cells
   Os06t0163400-01 (Os06g0163400)
  Exosomal proteins of bladder cancer cells
   Os06t0163400-01 (Os06g0163400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:join(3199483..3199970,3200070..3200199,3200340..3200505,3200773..3200891,3201064..3201144,3201244..3201330,3201652..3201723,3201799..3201867,3202357..3202434,3202548..3202688,3203341..3203394,3203473..3203589)
AA seq 533 aa AA seqDB search
MRARRVVAAAAVLLLFAVVAVARLDLDDDGDDSEVLDELLAVDEEEERGELGGGGEAAAA
EAVRRAQSMVLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAALRAMGSA
VAFAKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPASR
IQSKDSAEEFLKKDQTFAVGLFKNFEGAEYEEFVKAATSENEVQFVETNDRNVAKILFPG
IASEEQFLGLVKSEPEKFEKFNGAFEEKEIIQFVELNKFPLITVFTDLNSGKVYGSPIKL
QVFTFAEAYDFEDLESMIQEVARGFKTKIMLIYVDTAEEKLAKPFLTLYGLEPEKPTVTA
FDTSKGTKYLMEAEINAKNLQDFCLSLLEGTLPPYFRSEPVPEEKGPIEKVVGRTFDSSV
LESPQNVFLEVHAPWCVDCEAISKNVEKLAKHFNDLGQTNLKFARIDASVNEHPKLQINN
YPTLLLYPAQDKSNPIKLSKKSNLKDMAKFVKEKLQIADVETVAAGDIVKDEL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggagggttgtcgcggcggcggcggtgctgctgctgttcgccgttgtggcg
gtggcgcggctcgacctggacgacgacggggacgactcggaggtgctggacgagctgctc
gcggtggacgaggaggaggagagaggggagctcggtggaggaggggaggcggcggcggcg
gaggcggtgcggcgggcgcagtcgatggtgctggtgctcgacaacgacaacgcgcggcgc
gccgtggaggagaacgcggaggtgctcctgctgggctacgcgccgtggtgcgagcgcagc
gcgcagctcatgccgcggttcgccgaggccgccgcggcgctgcgcgccatggggagcgcc
gtcgcgttcgccaagctcgacggggagaggtaccccaaggccgcctccgccgtcggggtc
aaggggttccccaccgtcctcctcttcgtcaacggcaccgagcaccaattcactggcctc
cacaccaaggacgcgatagttacttgggtaagaaagaagactggtgcaccagctagtagg
attcagtcaaaggattccgctgaggaatttctgaaaaaggatcaaacttttgctgttggt
cttttcaaaaattttgagggagcagaatatgaagaattcgtgaaagcagcaacctcagaa
aatgaagtgcaatttgtcgaaaccaatgataggaatgtggccaaaattctttttcctggt
attgcatctgaagagcaattcctgggccttgtgaaaagcgagccagaaaagtttgagaag
ttcaacggggcatttgaagaaaaggagataattcaatttgtggagcttaacaagttccca
cttattactgtattcactgatctcaactctggtaaagtttatgggagccctattaagcta
caggtcttcacctttgcagaggcttatgatttcgaagatcttgaatctatgatccaagag
gttgccagaggattcaaaacaaagataatgcttatatatgtggatactgctgaagaaaag
cttgctaaaccattcctgactctctatggactcgaaccagaaaaacctactgtgacagca
tttgataccagcaaaggtaccaaatatctgatggaggcagaaattaacgcgaagaaccta
caggacttctgcttaagccttctggagggtacacttccgccatacttccgatcagaacca
gtaccagaagaaaagggacctattgaaaaggttgttggccgtacatttgattcttcagtt
ctagaaagtcctcaaaatgtgttccttgaggttcatgcaccttggtgtgttgactgtgag
gccataagtaaaaacgtggagaagttggccaaacatttcaatgatttgggccagactaat
cttaaatttgcacgcatagatgcttctgtgaatgaacatcccaaattgcagataaacaac
taccctacactgttgctatatcctgcccaagacaaaagcaacccgataaaactttcaaag
aaatcaaatctgaaggacatggcaaaattcgtcaaggagaagctgcaaattgcggatgtc
gaaacagtagccgctggtgacattgtcaaggatgagctatag

DBGET integrated database retrieval system