KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0164100-02Help
Entry
Os06t0164100-02   CDS       T02163                                 

Gene name
Os06g0164100
Definition
Similar to Serine/threonine protein phosphatase PP1 (EC 3.1.3.16).
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Os06t0164100-02 (Os06g0164100)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Os06t0164100-02 (Os06g0164100)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Os06t0164100-02 (Os06g0164100)
Transcription machinery [BR:dosa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Os06t0164100-02 (Os06g0164100)
Spliceosome [BR:dosa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Os06t0164100-02 (Os06g0164100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(3266974..3267151,3265573..3266132,3264527..3264757))
AA seq 322 aa AA seqDB search
MDAAALDDLIRRLLDARGGRTARPAQLADAEIRKLCAAAKDVFLSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSIETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFFDECKRRFNVRIWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLKNM
DQIRNIARPVDVPDHGLLCDLLWSDPDKEIEGWGENDRGVSYTFGADKVAEFLQTHDLDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSIDDSLTCSFQILKPSDKKG
KAGTGNMSKPGTPPRKIKINII
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggcggcgctcgacgacttgatccggcggctcctggacgcccgcggcggccgc
acggcgcgccccgcgcagctcgccgacgcggagatccgcaagctctgcgccgccgccaag
gacgtcttcctctcccagcccaacctcctcgagctcgaggcccccatcaaaatctgcgga
gatatccatggccagtattctgatcttcttcggttatttgagtatgggggcttcccacca
gaggcaaactacttgtttctaggtgattatgttgaccgtgggaaacagagtatagaaact
atatgtcttctccttgcgtataagattaagtacccagagaacttcttcctccttagggga
aaccatgagtgcgcatctatcaaccgaatctacggattctttgatgaatgcaaaaggagg
tttaatgttcgtatttggaaggtttttactgattgtttcaactgcctccctgtggctgca
cttattgatgacaagatcctatgcatgcatgggggtttatctcctgacctaaagaacatg
gaccagattcgcaacattgcccgcccagttgatgttccagaccatggtctcctgtgtgat
ctgttgtggtcagacccagataaagaaatcgaaggttggggtgagaatgacaggggtgta
tcatacacttttggagctgataaggtcgctgagtttctccagacacatgatctagatctg
atctgcagggctcaccaggttgtggaggatggctatgaattctttgctaagcgccagctt
gtaaccatattctctgcacccaactattgtggcgagtttgacaatgcgggggcgatgatg
agcattgatgattctcttacatgctcattccagatccttaagccttctgataagaaagga
aaagcaggaaccggaaatatgtcaaaacctggaactccaccaaggaagataaaaattaat
attatttag

DBGET integrated database retrieval system