KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0164100-02Help
Entry
Os06t0164100-02   CDS       T02163                                 

Gene name
Os06g0164100
Definition
Similar to Serine/threonine protein phosphatase PP1 (EC 3.1.3.16).
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:dosa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(3266974..3267151,3265573..3266132,3264527..3264757))
AA seq 322 aa AA seqDB search
MDAAALDDLIRRLLDARGGRTARPAQLADAEIRKLCAAAKDVFLSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSIETICLLLAYKIKYPENFFLLRG
NHECASINRIYGFFDECKRRFNVRIWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLKNM
DQIRNIARPVDVPDHGLLCDLLWSDPDKEIEGWGENDRGVSYTFGADKVAEFLQTHDLDL
ICRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSIDDSLTCSFQILKPSDKKG
KAGTGNMSKPGTPPRKIKINII
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggcggcgctcgacgacttgatccggcggctcctggacgcccgcggcggccgc
acggcgcgccccgcgcagctcgccgacgcggagatccgcaagctctgcgccgccgccaag
gacgtcttcctctcccagcccaacctcctcgagctcgaggcccccatcaaaatctgcgga
gatatccatggccagtattctgatcttcttcggttatttgagtatgggggcttcccacca
gaggcaaactacttgtttctaggtgattatgttgaccgtgggaaacagagtatagaaact
atatgtcttctccttgcgtataagattaagtacccagagaacttcttcctccttagggga
aaccatgagtgcgcatctatcaaccgaatctacggattctttgatgaatgcaaaaggagg
tttaatgttcgtatttggaaggtttttactgattgtttcaactgcctccctgtggctgca
cttattgatgacaagatcctatgcatgcatgggggtttatctcctgacctaaagaacatg
gaccagattcgcaacattgcccgcccagttgatgttccagaccatggtctcctgtgtgat
ctgttgtggtcagacccagataaagaaatcgaaggttggggtgagaatgacaggggtgta
tcatacacttttggagctgataaggtcgctgagtttctccagacacatgatctagatctg
atctgcagggctcaccaggttgtggaggatggctatgaattctttgctaagcgccagctt
gtaaccatattctctgcacccaactattgtggcgagtttgacaatgcgggggcgatgatg
agcattgatgattctcttacatgctcattccagatccttaagccttctgataagaaagga
aaagcaggaaccggaaatatgtcaaaacctggaactccaccaaggaagataaaaattaat
attatttag

DBGET integrated database retrieval system