KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0184300-01Help
Entry
Os06t0184300-01   CDS       T02163                                 

Gene name
Os06g0184300
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os06t0184300-01 (Os06g0184300)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os06t0184300-01 (Os06g0184300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(4218054..4218299,4217652..4217766,4216829..4216939,4216549..4216721,4216123..4216449,4215911..4216036,4215002..4215670,4214792..4214917,4214055..4214673,4213857..4213950,4213531..4213699))
AA seq 924 aa AA seqDB search
LHRRIEFHLARRSHSVVAVGGGGFRMETLNPDAGDRAAAGAAQGVGVAAGGEGEARRAEK
GEVVGGGLDPELSVARIYLGRIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGKHKSS
CRTAGFCALCALQNHVKTALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELMVNLLE
SMHKCCLPSGVPSESPSAYEKSLVHKIFGGRLRSQVKCTQCSHCSNKFDPFLDLSLDIGK
ATSLVRALQNFTAEELLDGGEKQYQCQRCRKKVVAKKKFTIDKAPYVLTIHLKRFSPFNP
REKIDKKVDFQPMLDLKPFISDSKGADFKYSLYGVLVHAGWNTQSGHYYCFVRTSSGMWH
NLDDNQVRQVREADVLRQKAYMLFYVRDRVGNPTPRKDNITANMPARRTIPEKISGLSDM
IQSGVIEAKLNGSSSPYGDKRLHGISNGNSIKTSREHYLKKDGKTEAPKASENNGLASTQ
KASAPQIDGATLSAQSKQITSTGHREVSSSDRSASLTHVIVNQAVAMVPSQELQPKVDGL
TDTSSLGNGNAILSERNKQTSQHQNPFSMPASHGKDTGAGLAAQTFPTKDAIVSNGVVPS
SRDPISSEKVCGLQKSIKQDDKTVKELPISENNIVSGLERVNARKQTSSEVSMKVAAADS
CNSNTPKRVDLKSKKLVRYPVMNMWLGPRQVMLGSLKVQKKKKCNRTRRRSVVCEDMANA
TCSGNNTSEQQASTSTTTSSETVQCTPRGRKRAYDSDSPKNNNQKQNKQDVIGADTGSGE
LNMDKRNVISETAASAELPKLGPGSSANQEHSRNNVHAKLGVPRHFTVLTRDLAEVTVPC
WDDVAVSNAEARESKHSESKSIGYVLDEWDEEYDRGKTKKIRNSKEDYGGPNPFQEEANY
ISQRNMKQRTYQPKSWKKHAHVRR
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
ctgcacaggaggatcgagttccacctcgcgaggaggtcgcactcggtggtggcggtcggg
ggaggcgggttccggatggagacgctgaaccccgacgcgggtgacagagcggcggcgggg
gcggcgcagggggtgggggtggcggcggggggcgagggggaggcgaggagggcggagaag
ggggaggtggtcggcggtgggctggatccggagctcagcgtcgccaggatctacctcggg
agaattggtgctggcctgcaaaatcttgggaacacttgctacctgaactcggtgctgcaa
tgcttgacgtacacagaaccatttgcggcctatttgcagagcgggaagcacaagtcttca
tgtcgtactgctggattttgtgcactatgtgctcttcaaaaccatgttaagactgctcta
cagtcaactggaaaaatagtgacgccatcacagattgtcaagaacttgcgctgcatctcc
cgtagtttccgcaattcaaggcaggaggatgcacatgagttaatggttaatttacttgaa
tccatgcataaatgttgtctaccttctggagtaccaagtgagtctcctagtgcatatgag
aagagcttagttcacaaaatatttggtggccgcctaagaagtcaggtgaaatgcacacag
tgctcacattgctccaacaaatttgatcctttcttggatctcagccttgatattggtaag
gccacgtctctggtgagggcacttcaaaatttcactgcggaagagctcttagatggggga
gaaaagcaatatcagtgccaacgctgcaggaaaaaggttgtagcaaagaaaaagtttaca
attgataaggcgccatatgttctgacaattcatctgaagcgctttagccctttcaacccc
cgtgaaaagattgacaaaaaagttgattttcagccaatgctagacttgaagccatttatt
agcgactctaaaggcgcagattttaaatacagcctttatggtgttttggttcatgctggt
tggaacactcagtcaggccattattattgcttcgttcgaacttccagtggaatgtggcac
aaccttgatgataaccaggtacgccaagtccgtgaggcagatgtattgagacagaaagca
tatatgttattttatgtacgtgacagagttgggaatccgactccacgcaaggataatatc
actgctaatatgccagccaggagaacaatacctgaaaagatctcaggtctgagtgatatg
atccagagcggcgtaattgaagcaaaattgaacggttcctcgtctccttatggcgataag
aggttgcacggcataagcaatgggaactcaatcaagacttcaagagagcattatttgaag
aaagatggcaaaactgaagctcctaaagcctctgaaaacaatggcctggcttccacacag
aaagcttctgcacctcaaattgatggtgctaccttatctgctcaatctaagcaaattact
tcaactggtcacagagaggtatcttcatcagatcgatctgcatctcttacacatgtgatt
gtgaaccaagcagtggccatggttccgtcgcaggaattgcaaccaaaggttgatggctta
accgatacctcttccctgggcaatggcaatgcgatattgtctgagcgaaataaacaaaca
tcccagcatcaaaatccattttctatgccagcttcccatggaaaggacacaggggcaggg
cttgctgcacaaactttcccaactaaggatgctattgtttcaaatggtgttgtacctagt
agcagggatccaatttccagtgagaaggtgtgtggcttgcaaaaatccatcaagcaagat
gacaaaacggtgaaagaacttcctataagtgagaacaatatagtatcaggacttgaacga
gtcaacgccagaaaacagactagctctgaagtttccatgaaggtagctgcagctgattcg
tgcaatagcaacacacctaaaagggtggatttgaagtcaaagaaacttgtgagatatcca
gtcatgaacatgtggcttgggcccagacaagttatgctaggttcactaaaggtacaaaag
aaaaagaaatgcaatagaactagaagacggtctgtagtttgtgaggacatggccaatgcc
acttgttcaggtaacaacacaagcgagcagcaggcatcaacatcaacaacaacgtcgtct
gaaactgtgcaatgtactcccagagggcggaaacgtgcctatgatagtgacagtcctaaa
aataataaccagaagcaaaacaagcaagacgttattggagccgatactggtagtggtgaa
cttaacatggataagagaaatgttattagtgaaaccgctgctagtgctgagcttccgaag
ctgggtccaggctcttctgcaaatcaggaacattcaaggaacaatgttcatgcaaaattg
ggagttccccggcattttactgttctgacaagggacttggctgaagttactgttccatgc
tgggatgatgttgctgtgtcaaatgctgaggcaagagagtcaaaacattcagaaagcaag
agcattggatatgtgttagatgaatgggacgaggagtatgaccgtggaaagaccaagaaa
atcagaaattcaaaggaagactacggtggaccaaaccccttccaggaggaggccaactac
atctcacagagaaacatgaaacagaggacctatcaacccaaatcctggaagaaacatgcc
catgttagaagatga

DBGET integrated database retrieval system