KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0185900-01Help
Entry
Os06t0185900-01   CDS       T02163                                 

Gene name
Os06g0185900
Definition
Similar to Glutathione peroxidase.
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dosa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dosa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:join(4321712..4321960,4322771..4322847,4322957..4323018,4323199..4323317,4323420..4323587,4324823..4324852)
AA seq 234 aa AA seqDB search
MASTTTTTAAAAARFTCLAPATRPASASASAGRFLLPARQWGAATTHGSAAVPVVAAPSR
RWAPGVAYATAATGKSVHDFTVKDIDGKDVALSKFKGRALLIVNVASQCGLTTANYTELS
HLYEKYKTQGFEILAFPCNQFGAQEPGSNPQIKQFACTRFKAEFPIFDKVDVNGPNTAPI
YKFLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEKDIQKLLAA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccaccaccaccacggcggcggccgcggcccgcttcacctgcctcgcgccg
gccacgcgccccgcctccgcctccgcctccgcgggccgcttcctcctcccggcgcggcag
tggggggcggcgacgacgcacgggagcgcggcggtgcccgtcgtcgcggcgccgtcgcgg
aggtgggcgccaggggtcgcctacgccaccgccgccaccgggaagagcgtccacgacttc
accgtcaaggacattgatggaaaagatgttgcgcttagcaagttcaagggaagggcgctg
ctaattgttaatgttgcatctcagtgtgggctgacaacagcaaattacacggaactatct
catctttatgagaagtacaagactcaaggatttgagattcttgcatttccttgcaatcag
tttggtgcacaagaacctgggtcaaacccgcagattaagcagtttgcttgtacaaggttt
aaagctgaatttcctatttttgacaaggttgatgtcaacgggcctaacacagcccctatt
tataagtttcttaagtcgagtgctggaggatttttgggtgatcttgtgaaatggaatttt
gagaagttcttggtggacaaaactggaaaagttgttgagagatacccacctacaacttca
ccattccagattgagaaggacatccagaaactccttgcggcataa

DBGET integrated database retrieval system