KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0185900-01Help
Entry
Os06t0185900-01   CDS       T02163                                 

Gene name
Os06g0185900
Definition
Similar to Glutathione peroxidase.
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Os06t0185900-01 (Os06g0185900)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Os06t0185900-01 (Os06g0185900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Os06t0185900-01 (Os06g0185900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:join(4321712..4321960,4322771..4322847,4322957..4323018,4323199..4323317,4323420..4323587,4324823..4324852)
AA seq 234 aa AA seqDB search
MASTTTTTAAAAARFTCLAPATRPASASASAGRFLLPARQWGAATTHGSAAVPVVAAPSR
RWAPGVAYATAATGKSVHDFTVKDIDGKDVALSKFKGRALLIVNVASQCGLTTANYTELS
HLYEKYKTQGFEILAFPCNQFGAQEPGSNPQIKQFACTRFKAEFPIFDKVDVNGPNTAPI
YKFLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEKDIQKLLAA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccaccaccaccacggcggcggccgcggcccgcttcacctgcctcgcgccg
gccacgcgccccgcctccgcctccgcctccgcgggccgcttcctcctcccggcgcggcag
tggggggcggcgacgacgcacgggagcgcggcggtgcccgtcgtcgcggcgccgtcgcgg
aggtgggcgccaggggtcgcctacgccaccgccgccaccgggaagagcgtccacgacttc
accgtcaaggacattgatggaaaagatgttgcgcttagcaagttcaagggaagggcgctg
ctaattgttaatgttgcatctcagtgtgggctgacaacagcaaattacacggaactatct
catctttatgagaagtacaagactcaaggatttgagattcttgcatttccttgcaatcag
tttggtgcacaagaacctgggtcaaacccgcagattaagcagtttgcttgtacaaggttt
aaagctgaatttcctatttttgacaaggttgatgtcaacgggcctaacacagcccctatt
tataagtttcttaagtcgagtgctggaggatttttgggtgatcttgtgaaatggaatttt
gagaagttcttggtggacaaaactggaaaagttgttgagagatacccacctacaacttca
ccattccagattgagaaggacatccagaaactccttgcggcataa

DBGET integrated database retrieval system