KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0265000-01Help
Entry
Os06t0265000-01   CDS       T02163                                 

Gene name
Os06g0265000, ASN, ASPARAGINE_SYNTHETASE
Definition
Similar to Asparagine synthetase.
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os06t0265000-01 (Os06g0265000)
Enzymes [BR:dosa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Os06t0265000-01 (Os06g0265000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C44
   Os06t0265000-01 (Os06g0265000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(8765480..8765559,8764170..8764308,8763775..8763870,8763516..8763657,8761871..8761966,8761590..8761686,8761137..8761296,8760859..8760939,8760546..8760767,8760226..8760360,8760049..8760129,8759867..8759953,8759637..8759744,8759303..8759554))
AA seq 591 aa AA seqDB search
MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD
QPLYNEDKSVVVTVNGEIYNHEELKANLKSHKFQTASDCEVIAHLYEEYGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFISFPPGHLY
SSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGGLDSSL
VASVVSRHLAEAKVAAQWGNKLHTFCIGLKGSPDLRAAKEVADYLGTVHHELHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKNFINVAMDIDPEWKMIKRD
LGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANEHVSDSMMMN
ASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGGPSVACSTAKAVEWDAAWSKNLD
PSGRAALGVHDAAYEDTLQKSPASANPVLDNGFGPALGESMVKTVASATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcctcgccgtgctcggcgtcgcagacgtctccctcgccaagcgctcccgc
atcatcgagctatcccgccggttacgtcatagaggccctgattggagtggtatacactgc
tatcaggattgctatcttgcacaccagcggttggctattgttgatcccacatccggagac
cagccgttgtacaatgaggacaaatctgttgttgtgacggtgaatggagagatctataac
catgaagaattgaaagctaacctgaaatctcataaattccaaactgctagcgattgtgaa
gttattgctcatctgtatgaggaatatggggaggaatttgtggatatgttggatgggatg
ttcgcttttgttcttcttgacacacgtgataaaagcttcattgcagcccgtgatgctatt
ggcatttgtcctttatacatgggctggggtcttgatggttcggtttggttttcgtcagag
atgaaggcattaagtgatgattgcgagcgattcatatccttcccccctgggcacttgtac
tccagcaaaacaggtggcctaaggagatggtacaacccaccatggttttctgaaagcatt
ccctccaccccgtacaatcctcttcttctccgacagagctttgagaaggctattattaag
aggctaatgacagatgtgccatttggtgttctcttgtctggtggactggactcttctttg
gttgcatctgttgtttcgcggcacttggcagaggcaaaagttgccgcacagtggggaaac
aaactgcatacattttgcattggtttgaaaggttctcctgatcttagagctgctaaggaa
gttgcagactaccttggtactgttcatcacgaactccacttcacagtgcaggaaggcatt
gatgcactggaggaagtcatttaccatgttgagacatatgatgtaacgacaattagagca
agcaccccaatgttcttgatgtcacgtaaaattaaatctttgggggtgaagatggttctt
tcgggagaaggttctgatgaaatatttggcggttacctttattttcacaaggcaccaaac
aagaaggaattccatgaggaaacatgtcggaagataaaagcccttcatttatatgattgc
ttgagagcgaacaaatcaacttctgcatggggtgttgaggcccgtgttccgttccttgac
aaaaacttcatcaatgtagctatggacattgatcctgaatggaaaatgataaaacgtgat
cttggccgtattgagaaatgggttctccggaatgcatttgatgatgaggagaagccctat
ttacctaagcacattctatacaggcaaaaggagcaattcagtgatggtgttgggtacagt
tggattgatggattgaaggatcatgcaaatgaacatgtatcagattccatgatgatgaac
gctagctttgtttacccagaaaacactccagttacaaaagaagcgtactattataggaca
atattcgagaaattctttcccaagaatgctgctaggttgacagtacctggaggtcctagc
gtcgcgtgcagcactgctaaagctgttgaatgggacgcagcctggtccaaaaaccttgat
ccatctggtcgtgctgctcttggtgttcatgatgctgcatatgaagatactctacaaaaa
tctcctgcctctgccaatcctgtcttggataacggctttggtccagcccttggggaaagc
atggtcaaaaccgttgcttcagccactgccgtttaa

DBGET integrated database retrieval system