KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0499900-01Help
Entry
Os06t0499900-01   CDS       T02163                                 

Gene name
Os06g0499900
Definition
Similar to Dihydrolipoamide acetyltransferase (E2) subunit of PDC (Fragment).
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dosa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dosa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dosa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dosa00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(17607326..17607354,17607173..17607229,17606825..17606861,17606731..17606764,17605486..17605535,17605346..17605390,17605154..17605227,17602364..17602433,17601802..17602197,17600873..17600933,17600754..17600798,17600576..17600659,17599823..17599899,17599682..17599744,17599224..17599294,17599076..17599136,17598940..17599000,17598774..17598854,17598183..17598241))
AA seq 484 aa AA seqDB search
MANIRALLIGLVRARGSLVDIGRCVSSSRPSYLASLGRHYKVPMEIRWLSSTGFPPHLVV
GMPALSPTMNQGNIAKWRKQEGEKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEGS
KDVQVGQPIAVTVEDLEDIKNIPADASFGGEQKEQSIASEAQKVETDAAKESSIITRISP
AAKLLIKEHRLDQSVLNASGPRGTLLKGDVLAALKLGASSSSTKQKNAPAAPSSQPTHDF
QAQSVTIPQQNDAYEDIPNSQIRKVIAKRLLESKQTTPHLYLSQDVILDPLLAFRNELKE
QHGVKVSVNDIVIKAVALALRNVPEANAYWNNDKEQAQKCVSVDISIAVATEKGLMTPII
RNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYPVDHFCAIINPPQSG
ILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGGKFFTELSQNFGDIR
RLLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacattcgggctcttctcatcgggttggtacgtgccaggggttccttggtggac
attgggcgatgcgtttcttcttcaaggccttcatatctagcgtcactgggcagacattac
aaggttcccatggaaattcgttggttatcctcaacagggtttcctcctcatctggtggtt
gggatgcctgcattatcccctactatgaatcaaggtaacattgcaaaatggagaaaacaa
gaaggtgaaaagatagaagttggtgatgtgatctgtgagatagaaactgacaaagctacg
cttgagtttgagagccttgaagaggggtatctggccaagatcttagcacctgaaggttca
aaagatgttcaggttggacagcccattgctgtcacggttgaagatcttgaggatattaaa
aatatacctgctgatgcttcctttggaggtgaacagaaagagcagtcaattgcaagtgaa
gcacaaaaggttgaaacggatgctgcaaaagagagctcgataataacccgtataagcccg
gcagcaaaattgcttatcaaggagcatcgtctagatcagtctgtactgaatgcatcgggt
ccccgtggcactcttctgaaaggggacgttcttgctgcattgaagttgggtgcctcctca
agttcaaccaagcaaaagaatgctccagctgcaccatcatctcagccaactcatgatttc
caagctcaatcagtcaccattccacaacaaaatgatgcatacgaagatatccccaacagt
cagatacgcaaggtgattgcaaaaaggttgcttgaatcaaagcagaccactccacattta
tatttatcacaagatgttatactggatcccttgctcgctttcaggaatgaactgaaagag
caacatggggttaaagtttcagtaaatgacattgtcataaaggctgttgcacttgcctta
cggaatgtaccagaagcaaatgcatactggaacaatgacaaggaacaagcccagaagtgt
gtttcagttgatatatctatcgcagttgctacagagaagggcctgatgactcctattata
agaaatgcagatcaaaagactatatcagcaatatcctcagaggttaagcagttggctgaa
aaggcacgtgctgggaagcttgctcctaatgaatttcagggagggactttcagcatctca
aatttgggaatgtacccagtcgaccacttctgtgcaatcatcaatcctcctcagtctgga
attcttgctgttgggcgtggtaataagattatcgagcctgtggtggacagtgatggaacc
gagaaggctacagtggttacaaaaatgagcttgacattgtccgctgaccatcgtgtattt
gatggtcaagtaggaggcaagtttttcacagagttgtcacagaattttggtgacattagg
agactgctattgtaa

DBGET integrated database retrieval system