KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0583400-01Help
Entry
Os06t0583400-01   CDS       T02163                                 

Gene name
Os06g0583400, CLASS-1_TYPE_HISTONE_DEACETYLASE_1, HDAC1
Definition
Class-I type histone deacetylase, Seedling root growth
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Os06t0583400-01 (Os06g0583400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr06:complement(join(22799574..22800113,22799058..22799498,22798370..22798600,22797725..22797816,22797568..22797631,22795071..22795151,22794836..22794943))
AA seq 518 aa AA seqDB search
MDASAGGGGNSLPTAGADGAKRRVCYFYDAEVGNYYYGQGHPMKPHRIRMTHALLAHYGL
LDQMQVLKPHPARDRDLCRFHADDYVAFLRSVTPETQQDQIRALKRFNVGEDCPVFDGLY
SFCQTYAGGSVGGAVKLNHGHDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKYHQ
RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDIGHSKGKYYSLNVPL
DDGIDDESYQSLFKPIMGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVRFM
RSFNVPLLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPPNEYFEYFGPDYTLHVAPS
NMENKNTRQQLDDIRSRLLDNLSKLRHAPSVQFQERPPEAELPEQDEDQEDPDERHHADS
DVEMDDVKPLDDSGRRSSIQNVRVKRESAETDAADQDGNRVAAENTKGTEPAADGVGSSK
QTVPTDASAMAIDEPGSLKVEPDNSNKLQDQPSVHQKT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctccgccggaggcggggggaactcgctgccgacggcgggggccgacggggcc
aagcggcgggtgtgctacttctacgacgcggaggtggggaactactactacgggcagggg
cacccgatgaagccgcaccgcatccggatgacccacgcgctgctcgcccactacggcctc
ctcgaccagatgcaggtgctcaagccccacccggcgcgcgaccgcgacctctgccgcttc
cacgccgacgactacgtcgccttcctccgctccgtcacgccggagacccagcaggaccag
atccgggcgctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggcctctac
agcttctgccagacctacgccgggggatccgtcggcggcgccgtcaagctcaaccacggc
cacgacatcgccatcaactgggccggcggcctccaccacgccaagaagtgcgaggcctcg
ggattctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaaataccaccag
cgtgttctctatgtggatatcgatatccaccatggggatggtgtggaggaggcgttctac
acgacggacagggtgatgacggtctcgttccacaagtttggggattatttcccggggacc
ggggacattcgcgatattgggcactcaaaggggaagtattactctctgaatgtcccgttg
gacgacggtatcgacgacgagagctaccagtcgttgttcaagccgatcatggggaaggtg
atggaggtttttcgccctggcgcggtggtgctccagtgcggtgcggactctctgtcgggt
gataggttgggttgcttcaacctgtcaatcaggggccacgcggaatgcgtgagattcatg
aggtccttcaatgtcccgctgttgctgcttggtggtggtgggtataccataagaaatgtt
gcgcggtgttggtgctatgagacaggagttgcacttggtcatgagctcactgacaagatg
cctccaaatgagtattttgagtactttggtccagattatacacttcatgttgcaccaagt
aacatggagaacaaaaacacacgccagcagttggatgatataagatcaagacttcttgat
aatctttcaaaacttcgacatgctcctagcgtccaatttcaagagcgaccccctgaggct
gagctacctgagcaagatgaagaccaagaggatcctgatgaaaggcaccatgctgattct
gatgtggaaatggatgatgtcaaacctttggatgactcaggaaggaggagcagtattcag
aatgtgagagttaagagagagtctgctgaaacagatgccgcagatcaggatggtaatagg
gtcgctgcagagaacaccaagggcacagaacctgcggctgatggagttggttcctcgaaa
caaactgttcctaccgatgcaagtgcgatggccatagacgaaccaggctccctgaaagtc
gagccagataactcaaacaaattgcaagatcaaccatcggtgcaccagaagacataa

DBGET integrated database retrieval system