KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0622500-00Help
Entry
Os06t0622500-00   CDS       T02163                                 

Gene name
Os06g0622500
Definition
Similar to predicted protein.
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Os06t0622500-00 (Os06g0622500)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Os06t0622500-00 (Os06g0622500)
Ubiquitin system [BR:dosa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Os06t0622500-00 (Os06g0622500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(25027917..25028105,25027773..25027838,25026872..25026991,25026708..25026784,25026309..25026428,25025970..25026189,25025336..25025617,25025002..25025070))
AA seq 380 aa AA seqDB search
MWTDNVTSTSSSTSIVDGRYPEQEKSERVLSQDSKLAIGIRELMALLRTLGEGYRLSCLF
KCQEALEVYRKLPEAQFNTGWVLCQVGKTYFELVNYLEADHFFELAHRLSPCTLEGMDIY
STVLYHLNEEMRLSYLAQDLVSIDRLSPQAWCAVGNCFALRKDHETALKNFQRAVQLDSR
VAYAHTLCGHEYSALEDYENSIKLYRSALQVDERHYNAWYGLGVVYLRQEKFEFAEHHFR
RAFQINPCSSVLMCYLGMALHALKRNEEALEMMENAIFADKKNPLPKYQKALILLGLQKY
PDALDELERLKEIAPHESSMYALMGKIYKQLNILDKAVFCFGIALDLKPPAADVAIIKSA
MEKVHLPDELMDDDDDDDEI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtggacagataatgtaacttcaacttcgtcttctacaagtatagttgatggaagatat
cccgagcaagagaaatctgaacgagttctgtcacaggactccaaattagctattggtatc
agggagctaatggcactcttgcggacactaggggaagggtataggctttcttgcttgttt
aagtgtcaggaagcattggaagtatatagaaagctcccagaggcacaatttaatactgga
tgggttctttgccaggttgggaagacatattttgaactcgtcaattatttagaagccgat
catttttttgagttagcgcatcgactatcaccatgcacgttggagggaatggacatttac
tccactgttctttatcatttgaatgaggaaatgcggctaagttaccttgctcaagatctt
gtttctattgatcgactatctccccaagcatggtgtgctgtgggaaattgctttgccttg
aggaaagatcatgagactgccttgaagaattttcaacgtgctgtacagcttgactcaaga
gttgcatacgctcacacgctatgcggtcacgagtattctgcattggaggattatgagaac
agtataaaactataccgctctgcacttcaggtagatgaaagacactacaatgcctggtat
ggccttggagtggtgtaccttcgccaggaaaagtttgagtttgctgagcatcatttcaga
agggcattccagataaatccttgctcttctgttcttatgtgctatcttgggatggccttg
catgctttaaagaggaatgaggaagccttggaaatgatggagaacgctatatttgctgat
aagaagaatccactccccaagtatcaaaaggctttaatccttctaggcctacaaaaatac
cctgatgctctggatgagttggaacggctaaaggaaattgcacctcatgaaagtagtatg
tatgcactgatgggaaagatttacaagcaacttaacattcttgacaaggctgtattttgc
tttggcattgccctggatttgaaacctcctgctgctgacgttgctataatcaagtctgca
atggagaaagtacaccttccagatgaacttatggatgatgatgatgatgatgatgagatt
taa

DBGET integrated database retrieval system