KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0626700-00Help
Entry
Os06t0626700-00   CDS       T02163                                 

Gene name
Os06g0626700
Definition
(RAP-DB) Isopenicillin N synthase family protein.
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00941  Flavonoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00138  Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os06t0626700-00 (Os06g0626700)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     Os06t0626700-00 (Os06g0626700)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Motif
Other DBs
RAP-DB: Os06t0626700-00
Position
chr06:complement(25296195..25297316)
AA seq 373 aa AA seqDB search
MTDVELRVEALSLSDVSAIPPEYVRLEEERTDLGDALEVARAASDDADAARIPVVDISAF
DGDGRRACVEAVRAAAEEWGVMHIAGHGLPGDVLDRLRAAGEAFFALPIAEKEAYANDPA
AGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRVRT
LASKLLAILSLGLGLPEETLERRLRRHDQHGVDDDLLLQLKINYYPRCPRPDLAVGVEAH
TDVSALSFILHNGVPGLQAHHAGTWVTARSEQGTIVVHVGDALEILTNGRYTSVLHRSLV
SRDAVRVSWVVFCEPPPESVLLQPLPELLANGAGKPLFAPRTFKQHVQRKLFKKLKDQQD
NNAAAASNGIIPK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtggagctgagagtggaggccctcagcctgagcgacgtctccgccatcccg
ccggagtacgtccgcctggaggaggagcgcacagacctcggcgacgccctggaggtcgcc
cgggccgcgtccgacgacgccgacgccgcccgcatccccgtcgtcgacatctccgcgttc
gacggcgacggcaggcgcgcgtgcgtggaggcggtgcgcgcggcggccgaggagtggggc
gtcatgcacatcgccggacacggcctcccgggcgacgtcctcgaccgcctgcgtgccgcg
ggcgaggcgttcttcgcgctgcccatcgcggagaaggaggcgtacgccaacgacccggcg
gcggggcggctgcaggggtacggcagcaagctcgccgccaacgccagcgggaagagggag
tgggaggactacctgttccacctcgtccacccggaccacctcgccgaccactcgctctgg
ccggcgaacccgccggagtacgtccccgtgtcgcgcgacttcggcggccgcgtccggacc
ctcgcgtccaagctgctcgccatcctctccctcggcctcggcctgccagaagagacgctg
gaacggcgcctgagaagacatgatcagcacggcgtcgacgacgacctgcttctccagctc
aagatcaactactacccgaggtgcccgcggcctgacctcgccgtcggcgtcgaggcacac
accgacgtcagcgcgctctccttcatcctccacaacggcgtgccgggactgcaggcgcac
cacgccgggacctgggtcaccgcgcgctccgaacagggcaccatcgtcgtccacgtcggc
gacgccctggagatcctcaccaacggccggtacaccagcgtgctccaccgcagcctcgtc
agccgcgacgcagtgcgcgtctcctgggtcgtcttctgcgagccgccgccggagtccgtg
ctgctgcagccgctgccggagctgctcgccaacggcgccggcaagccgctcttcgcgccg
cgcacattcaagcagcacgtgcaacgcaagctgttcaagaagctcaaggatcagcaagac
aacaatgccgcagctgcatcgaacggaattatacctaaataa

DBGET integrated database retrieval system