KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0643600-01Help
Entry
Os06t0643600-01   CDS       T02163                                 

Gene name
Os06g0643600
Definition
DNA glycosylase/AP lyase domain containing protein.
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Os06t0643600-01 (Os06g0643600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Os06t0643600-01 (Os06g0643600)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Os06t0643600-01 (Os06g0643600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:complement(join(26232558..26232792,26232418..26232469,26232286..26232343,26231673..26231741,26231456..26231581,26231280..26231330,26231128..26231205,26230935..26231034,26230757..26230791,26230268..26230666))
AA seq 400 aa AA seqDB search
MPELPEVEAARRALEAHCVGRRIARCAVADDPKVVVAAAGGRVAFERAMVGRTIVAARRR
GKNLWLRLDAPPFPSFQFGMAGAIYIKGVPVTKYKRSVVSSTDEWPSKYSKFFVQLDDGL
EFSFTDKRRFARVRLFEDPETVPPISELGPDALFEPMSSDSFADSLSRKKIGIKALLLDQ
SFISGIGNWIADEVLYQSRTHPLQIASSLSRESCEALHQSIQEVVKYAVEVDADCDCFPV
EWLFHHRWGKKPGKVNGQKIEFITAGGRTTAYVPQLQKLTGMQSSKVVIANPEQVAENDD
AKEIDTDPEDADNLNTKKRGATSRVARGKQKRDAIGALSRKTRKNGGGKEKPGSDYSEDD
GETAEPNKVSTSSKGEKADPVRRSSRTASKPRQVNKLKER
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgaggagggcgctggaggcgcactgcgtgggg
aggaggatcgcgcgctgcgcggtggcggatgaccccaaggtggtggtcgccgccgccggg
gggcgcgtggcgttcgagcgcgccatggtcggccggaccatcgtcgccgcgcggcggagg
ggcaagaacctctggctccgcctcgacgcccctccattcccctccttccagttcgggatg
gcaggtgcgatctacattaagggagttcctgtgaccaagtacaagagatcagttgtcagt
tctacagacgagtggccctccaagtactccaaattttttgttcaacttgatgatggctta
gagttttccttcactgataagaggcggtttgcaagagttcggttgtttgaagatcccgaa
actgtacccccgatttctgagttaggaccagatgctctctttgagccgatgtcttctgac
agttttgcggactcgctgagcagaaagaagattggaataaaagctcttctactcgatcag
agcttcatatcaggaattggtaattggattgcagatgaggtgctttaccagtcgagaacc
catccattacagattgcttcaagtctatccagggagagttgtgaagcactacaccaaagc
atccaagaggttgtgaaatatgctgttgaagttgatgctgattgtgactgctttcctgtg
gaatggttattccatcaccgatggggcaagaagcctggtaaagtcaatggacagaaaatt
gagttcataacagctggtggcaggactacagcatacgtgccacaactgcagaagctgact
ggaatgcaatctagcaaagtagtcattgctaacccagaacaagtggcagagaacgatgat
gcgaaggaaatagacacagatccagaagatgctgataatttgaatacaaagaagcgagga
gcaacttctagggttgccaggggaaagcaaaagagagatgccataggtgccctttccaga
aagacaaggaaaaatggtggtggcaaggagaaaccaggtagtgactatagtgaagatgat
ggtgagactgctgaaccaaacaaagttagcaccagtagcaagggcgagaaggcagatccg
gtgagaagatcatcaaggaccgcatcgaaaccccgccaggtaaataaattaaaagaaaga
tag

DBGET integrated database retrieval system