KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0654000-01Help
Entry
Os06t0654000-01   CDS       T02163                                 

Gene name
Os06g0654000
Definition
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family protein.
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os06t0654000-01 (Os06g0654000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os06t0654000-01 (Os06g0654000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr06:complement(join(26790216..26790386,26790031..26790119,26789854..26789939,26789607..26789775,26789397..26789520,26789113..26789270,26788428..26788512,26788125..26788334,26787974..26788035,26785806..26787486))
AA seq 944 aa AA seqDB search
SQGCQSKHWQSGHKFKCKQMKKSSPADKLSGGGEEDRNKLSGFGPISLVPARRKLNKVIF
PYDEFLKLCNWRDLDYLPCGLLNCGNSCFANVVLQCLSCTRPLAAYLLGMDHSRECYKRH
EDWCFLCELQCHIQRASESMHPFAPKNILSHLPNIGGNLGFGRQEDAHEFMRFAIDKMQS
ACLDEFGGEKAVDPSTQETTLIQHIFGGRLQSQVQCTACGMVSNRYENMMDLTVEIHGDA
DSLEECLDKFTAVEWLDGDNKYKCDGCSDYVKAQKRLTVYQAPNILTITLKRFQSGRFGK
LNKRVTFPMKLDLTPYMSSTDGSDQYDLYAVVVHLDMLNASFFGHYICYIKNYRGRWYKI
DDCKVMAVDEEEVHAQGAYMLLYSRRTARPRPLIAVEELMKQQQQLKVCPLNGQNHLIQE
DVPLEGVPSLKPSEDLEVDFESNNKSLHTMDREPDLDFHVSFDRDKFTNNDIMHPPVSTV
SHALDENTRGDSGFPLEESNTMGSVQFGNSTYETSLVHSPAEQCEEPASCIDSVDYMEID
TEAGVKVERWSRPALGDSVGVMGNGTLVPALENGLAGKPIPGFPDKPSRINSFFAEGCQT
GDNGAGSSQELNGHCNGEPSCPEQGVLTNGGNTPSPSTQCYENKFATSTNGNYSIGNGDT
LSSSNSLHAGKQNAGFTYNGFNPKPYKEPSGSNTYLNNTCNGKPSEDNHNKCAPNLPAKD
CQGGMPFLHRGFLLRPCSRGNPGKCDDGLSISNGTSSSFVSSNSKSSNISSSRNGEGGTP
FLSPSFRTNHCRESAAMDTSASSVHDLKTSYNISLEQKSIGAAVPSDLIKESWGEDGTTF
GTVYQQRATSVDNVSSRHDENGHVILGANNSSYGGENGSNNGILDMNSSSSQRDAASSTM
MASEKGIGPKTADQVNYISDALEHDGLRRRLTSNFPDQNGIDAQ
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
tctcaaggatgtcagtcaaagcattggcaatctggtcacaagttcaagtgcaaacaaatg
aaaaaatcaagccctgctgacaagctatcaggtggaggcgaggaagacagaaataagtta
tctggttttggtcccatctcattagtacctgcccgtagaaaattaaacaaggtcatcttt
ccatatgatgaatttctaaagctgtgcaactggagggaccttgattatttaccttgtggc
cttttgaattgtggcaacagttgctttgccaatgttgttttacaatgtctttcatgtacg
aggccacttgcagcctatctcttaggaatggaccatagcagggaatgttataagagacat
gaagattggtgtttcttgtgcgaactgcaatgccatatccaaagggcaagtgaaagtatg
catccatttgcgccgaagaacattctttctcacctgccaaatataggtgggaaccttggc
tttggtagacaagaggatgctcatgaattcatgaggtttgcaatagataagatgcaatct
gcttgtcttgatgaatttggaggcgagaaggctgtagaccctagcacgcaagaaacgact
cttattcaacacatatttggtggtcgtctgcaatcccaggttcaatgtactgcatgtgga
atggtctcaaatcgctatgagaatatgatggacttaacagttgaaattcatggtgatgct
gactccttggaagaatgcttagataagttcactgcagtagagtggcttgatggtgataat
aagtacaaatgtgatggatgcagcgactatgtcaaagcacagaaacgtcttacagtttat
caagctccaaatatcctcacaattactctgaaaagattccagagtggtagatttgggaaa
ctaaacaagagagttacattcccaatgaagttagacctaacgccatacatgagtagcact
gatggaagtgaccaatacgatctctatgctgttgttgttcatctggatatgctcaatgct
tcattttttgggcattatatatgctatataaaaaattaccgaggacgctggtataaaatt
gatgactgcaaggttatggctgttgatgaggaggaagtacatgctcaaggtgcttatatg
cttctatatagcaggagaacagctcgccctaggccactaattgcagtagaagaactcatg
aaacagcagcaacagttgaaagtatgccctttgaatggacaaaatcatttgatacaagag
gatgtgccattagaaggcgtgccatctttgaaaccctcagaagatctggaagttgatttt
gaatccaacaacaaatctttacatactatggacagagagccagacctggattttcatgtg
agctttgatagagataagttcactaacaatgatattatgcacccaccagtttcaacggta
tcgcatgcccttgatgaaaatactagaggagattcaggttttccattggaagaatcgaac
accatgggatctgtgcaatttggcaactccacatatgaaacatctttagtgcattcccct
gcagagcagtgtgaagaacctgcgtcatgtattgattcagttgactacatggaaattgac
actgaagctggcgttaaagttgaaagatggagcaggcctgccttaggtgattcagttgga
gtgatggggaatggtacattggtcccggcattggagaatggtttggcgggtaaaccaatt
cctggttttcccgacaaaccctcgagaataaattcattctttgcagaaggatgtcaaact
ggtgacaatggtgctggttcctcgcaagagttgaatggtcattgcaatggagaacccagt
tgcccagagcaaggagttctgaccaatggtggcaacacgccctctccaagcacacaatgc
tatgaaaataagtttgcaacatccaccaacggcaactattctattgggaatggtgataca
ttatctagcagcaactcattacatgcgggcaaacagaatgctggctttacctataatggt
ttcaatccaaaaccttacaaagaaccatcaggaagcaacacatatctgaataatacatgc
aatggtaaaccatcggaagataatcacaataaatgtgccccaaacctgccggcaaaagat
tgccaagggggcatgccattcttacatcgtggcttccttctaaggccttgttctagggga
aatccaggcaaatgtgatgatggcttgtcaattagtaatggcacatcatcatcctttgtg
agtagtaacagcaaatcaagtaatatttcatcatctcgaaatggtgaaggaggcacacca
ttcttgtctcctagttttcgcacaaatcattgcagagagtcagctgccatggacacctct
gcaagctctgtccatgatttgaaaaccagctataacatttccttggagcaaaaatctatt
ggtgctgcagtaccgtcagacctgataaaagaaagttggggtgaagatggcacgactttt
ggcactgtttaccaacaaagagcaacttctgttgataatgtaagcagccgccatgatgaa
aatgggcatgtgattttgggtgccaataattccagttatggaggagaaaacggcagtaat
aatggaattcttgatatgaatagcagcagtagccaaagggacgcagcatctagtaccatg
atggcttctgagaaaggcataggacctaaaacagctgaccaagtcaattacatatctgat
gcacttgaacatgatggtttgcgacgaagattaacctcaaattttcctgatcagaatggt
attgatgctcaataa

DBGET integrated database retrieval system