KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0656000-00Help
Entry
Os06t0656000-00   CDS       T02163                                 

Gene name
Os06g0656000
Definition
Hypothetical conserved gene.
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:dosa00460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr06:join(26904473..26904565,26904673..26905065,26905264..26905579,26906521..26907421,26907755..26907836)
AA seq 594 aa AA seqDB search
HHPPWPPFPPASTSSSPLSSSRQPSPPPSPAGWWRRRRRTRGTWWTRRRRRRRRRTTTSW
SGEARRGARSPRRWPGRGAGACWCWSGAARPRSSRRSPPRAGSSGRSPWRTRRPSRTRPR
RPSPPRTACPTSAPASSAAPPPSTPASTRAPTLTGSAATARSGGEAMNWDMKLVNSSYEW
VERELAFQPVVRGWQAAVRAGLLEANVTPWNGFTMDHVSGTKVGATTFDSSGRRRSAADL
LAFARPGRLRVAIRATVTRIIMSPIEPVARRGRSPQPAVAASGVVYQDRLLQQHHALLRP
GGEVILSAGSLGSPQLLLLSGIGPANDLTSLGIPVFADVPDVGKHMFDNPRNGISIIPSI
PIDHSLIQVVGIPSANGNESYLEAASYIVPLAPILRRGGPFSPSSPLYVTVVTIMEKVPG
PLSEGSLWLTSSNPLESPSVRFNYLSRREDLARCVTGMRRVAKVLESTTMDVFRSAMGSL
SQDSRRREFRIVGAALPVDWRTNDTALGDFCQQTVATLWHYHGGCVAGSVVDRDFRVFRV
RALRVVDGSTFRETPGTNPQATIMMMGRYIGQKMIDERHSRRQVRTSTDSSSNA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
caccacccgccatggccgccattcccacccgcctccacctcctcctcgccgctctcctcg
tcgcgccaaccctcgccgccgcccagccccgcggggtggtggcgccgccgccggcgtacg
cgcggtacgtggtggacgcggcggagacggcggcggaggaggcgtacgactacatcgtgg
tcgggggaggcacggcggggtgcccgctcgccgcgacgctggccgggccggggggcgggc
gcgtgctggtgctggagcggggcggcgcgcccgcggagttcccgccgctcgccaccgcgg
gcgggttcgtcaggacgctcgccatggcggacccggcgcccgagtcggacgcgcccgcgc
agaccttcgcctccgaggacggcgtgcccaacgtccgcgcccgcgtcctcggcggcgcca
cctccatcaacgccggcttctactcgcgcgcccaccctgactggttccgcagccacggcg
aggtcaggtggtgaggcgatgaattgggacatgaagctagtgaattcgtcctacgagtgg
gtggagcgtgaactggcgttccagccggtggtgcgtgggtggcaggcggcggtgcgtgcg
gggttgctggaagctaatgtgacgccatggaacgggtttacaatggaccatgtctctggc
accaaggttggtgccaccacgttcgattcgtcaggccgccgccggagtgccgcagatctc
ctcgcctttgcacgccctggccgtctccgtgttgccatccgtgcgacggttactcgcatc
atcatgagcccaattgaacctgttgcacgccgtggaaggtctccacagccagcagtagca
gcaagcggtgtcgtttaccaggaccgtcttctccagcagcaccacgcattgttgcgccca
gggggggaggttatactttctgcaggctccctagggagtccccagttgctgctcctcagt
ggcattggccctgccaatgatcttacatccctaggcatcccagtttttgctgatgtccct
gatgttggcaagcatatgtttgacaacccccgtaacggcatctccatcatcccatcaatc
ccaatcgatcactcccttatccaggtagttggcattccttctgctaatgggaatgagtcc
taccttgaggctgcatcatacattgttccccttgctcccatcttacgccgtggtggtccg
ttcagcccgtcttcgccactttatgttactgtggtaaccatcatggaaaaggttcctgga
ccattgtctgaaggttcactttggctcacatcatccaatcccttggagagcccttcagtg
cggttcaactacttgagccgtcgtgaggacttggcacggtgtgtgacgggcatgcggcgt
gtggcgaaagtgcttgagagcacgacaatggatgtgtttcgttcagcgatgggatcattg
agccaagacagcaggaggagggagttcaggattgttggggctgcactgccagttgactgg
agaacaaatgacacagctctgggtgatttctgccagcagactgtggcaacattatggcat
tatcatggaggatgtgtagctggaagtgtggttgacagggatttccgtgtttttcgtgtg
cgtgctcttcgtgtggtggatggatcaacattcagggaaacacctgggaccaatcctcaa
gccacaatcatgatgatgggcaggtatatagggcagaagatgattgatgagcgtcacagc
agaaggcaagtcagaacatcaacagattcctcttccaacgcctga

DBGET integrated database retrieval system