KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0699400-01Help
Entry
Os06t0699400-01   CDS       T02163                                 

Gene name
Os06g0699400, MITOGEN-ACTIVATED_PROTEIN_KINASE_4, MAPK4
Definition
MAP kinase 2.
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Os06t0699400-01 (Os06g0699400)
Protein kinases [BR:dosa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Os06t0699400-01 (Os06g0699400)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os06t0699400-01 (Os06g0699400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Position
chr06:join(29399805..29400227,29401457..29402143)
AA seq 369 aa AA seqDB search
MAMMVDPPNGMGNQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRATNEKVAI
KKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLA
RTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSEADIEFIDNPKARKYIKTLPYTPGIPLTSMYPQAHPLAIDLLQKML
VFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMLHYH
PEVVAGVNM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggaccctcctaatggcatgggaaaccaagggaagcattactacaca
atgtggcaaacgctatttgagattgacaccaagtatgtgccaatcaagcccatcggaaga
ggggcttatggaatagtttgctcctctataaaccgtgcaaccaacgaaaaagttgcaata
aagaagatcaacaatgtctttgacaaccgtgtggatgcactgaggaccctaagggagctg
aaactactgcgacacttgcgccatgaaaatgttattgccttgaaagatataatgatgcca
gtacacagaaggagtttcaaagatgtatacttggtttatgaactcatggacacagatcta
caccagataattaaatcatctcaacctctttctaatgaccactgtcaatatttccttttt
cagctactccgaggtctgaagtacctccattcagcagggatactccatcgagacctgaaa
ccagggaacctcctggttaatgcaaactgcgatctgaagatctgcgactttggtttggct
cgcacaaacaacactaaaggccagtttatgactgaatatgtcgtgacccggtggtatagg
gctcctgagctgctgctctgctgcgacaattacggaacctccatagatgtctggtctgtt
ggctgcatctttgctgagcttcttggccgcaagccaatatttccaggaactgagtgcctc
aatcagctcaagctcatagtcaacgttctcggcaccatgagtgaagctgacattgagttc
attgacaacccaaaggcccgcaagtatatcaagacccttccatacactcctggcatcccc
ctcaccagtatgtacccgcaagcacatcctcttgccattgatctgttgcagaagatgctc
gtctttgatccctccaaaaggattagtgtcactgaagctctggagcacccttacatgtct
ccactgtatgatccaagcgcaaaccctcctgctcaagtgcccatcgatctcgacatcgat
gaaaatcttggcgtggatatgatccgggagatgatgtggcaggagatgctccactatcac
ccagaggttgttgcaggagtgaatatgtga

DBGET integrated database retrieval system