KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0704600-01Help
Entry
Os06t0704600-01   CDS       T02163                                 

Gene name
Os06g0704600
Definition
Similar to Delta-aminolevulinic acid dehydratase (Fragment).
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Os06t0704600-01 (Os06g0704600)
Enzymes [BR:dosa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Os06t0704600-01 (Os06g0704600)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os06t0704600-01 (Os06g0704600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr06:complement(join(29761121..29761411,29760915..29761026,29760756..29760829,29760500..29760568,29760336..29760419,29760165..29760234,29759442..29759497,29759217..29759338,29759042..29759113,29758869..29758950,29758703..29758780,29757785..29757955))
AA seq 426 aa AA seqDB search
MASTVSFSPANVQMLQGRSCHGHAAFGGCSAVPRTGPRMRSVAVRVSSEQEAAPAVRAPS
GRTIEECEADAVAGRFPAPPPLVRPKAPEGTPQIRPLDLTKRPRRNRRSPALRAAFQETT
ISPANLVLPLFIHEGEDDAPIGAMPGCYRLGWRHGLLDEVYKSRDVGVNSFVLFPKVPDA
LKSQSGDEAYNDNGLVPRTIRLLKDKFPDIVVYTDVALDPYSSDGHDGIVREDGVIMNDE
TVYQLCKQAVSQARAGADVVSPSDMMDGRVGAIRAALDAEGFHDVSIMSYTAKYASSFYG
PFREALDSNPRFGDKKTYQMNPANYREALLETAADEAEGADILLVKPGLPYLDVIRLLRD
NSALPIAAYQVSGEYSMIKAGGALNMIDEEKVMMESLMCLRRAGADIILTYFARQAANVL
CGMRSN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccgtctccttctccccggccaacgtgcagatgctccagggcaggagctgc
cacggccacgcggcgttcgggggctgctccgccgtgccaagaaccgggccaaggatgcgt
tccgtggccgtgagggtcagcagcgagcaggaggcggcgccggcggtcagggcgccgtcg
gggaggaccatcgaggagtgcgaggccgacgccgtggccgggagattcccggctcccccg
ccgttggtcagacccaaggctcccgaaggaacacctcagatcaggcctcttgacttgaca
aagcgccctcgtcgcaaccgcaggtcgcctgctcttagggccgcattccaggagaccacc
atctcacctgccaatttggtgctcccgctgttcatccatgaaggggaagatgatgctcct
attggagctatgcctgggtgctataggcttggttggaggcatgggcttcttgatgaggtc
tacaagtctcgtgatgttggtgttaacagttttgtgctgtttccaaaagttcctgatgca
ttgaagtctcaatctggagatgaggcatacaatgataatggtttggttccacggactatt
cgcctgctcaaggataaattccctgacattgttgtctacacggatgttgctctggaccct
tattcatctgatggtcatgatggcattgtcagggaagatggagtaattatgaatgatgaa
acagtttatcaactgtgcaagcaggctgtttcacaggcacgtgctggtgctgatgtagtt
agccctagtgacatgatggatggccgtgttggagcaatacgtgctgctttggatgctgag
ggtttccatgatgtctccattatgtcctatactgcaaagtacgccagttcgttttatggc
ccattccgagaagctttggattcaaatccaagatttggggacaagaagacttaccagatg
aacccagctaactacagagaagcgcttctagaaactgctgcagatgaggcagaaggagct
gatattcttctggtaaaacctggattgccatacttggatgtcatccgtcttcttagggac
aattcagcattgccaatcgctgcatatcaggtctctggagagtactccatgatcaaagct
ggaggagcactgaacatgatcgacgaagagaaggtgatgatggagtcgctcatgtgcctg
aggcgagccggcgctgacatcatcctgacgtatttcgcgcgtcaggccgccaacgtgctg
tgcggcatgcgatccaactag

DBGET integrated database retrieval system