KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0726400-01Help
Entry
Os06t0726400-01   CDS       T02163                                 

Gene name
Os06g0726400, STARCH_BRANCHING_ENZYME_1, SBE1
Definition
Branching enzyme-I precursor (Starch-branching enzyme I) (1,4-alpha- glucan branching enzyme I).
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os06t0726400-01 (Os06g0726400)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Os06t0726400-01 (Os06g0726400)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os06t0726400-01 (Os06g0726400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
RAP-DB: 
Oryzabase: 
Structure
PDB: 

Jmol
Position
chr06:complement(join(30905603..30905686,30905438..30905500,30903015..30903222,30902830..30902899,30902126..30902395,30901111..30902017,30900682..30900798,30900462..30900524,30899916..30900023,30899345..30899446,30899112..30899179,30898949..30899030,30898715..30898831,30898429..30898632))
AA seq 820 aa AA seqDB search
MLCLTSSSSSAPAPLLPSLADRPSPGIAGGGGNVRLSVVSSPRRSWPGKVKTNFSVPATA
RKNKTMVTVVEEVDHLPIYDLDPKLEEFKDHFNYRIKRYLDQKCLIEKHEGGLEEFSKGY
LKFGINTVDGATIYREWAPAAQEAQLIGEFNNWNGAKHKMEKDKFGIWSIKISHVNGKPA
IPHNSKVKFRFRHGGGAWVDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRP
PKPDAPRIYEAHVGMSGEEPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGY
HVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHE
SYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHG
INKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGG
VGFDFRLAMAIPDRWIDYLKNKEDRKWSMSEIVQTLTNRRYTEKCIAYAESHDQSIVGDK
TIAFLLMDKEMYTGMSDLQPASPTINRGIALQKMIHFITMALGGDGYLNFMGNEFGHPEW
IDFPREGNNWSYDKCRRQWSLVDTDHLRYKYMNAFDQAMNALEEEFSFLSSSKQIVSDMN
EKDKVIVFERGDLVFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVD
HFTSPEGMPGVPETNFNNRPNSFKVLSPPRTCVAYYRVDEDREELRRGGAVASGKIVTEY
IDVEATSGETISGGWKGSEKDDCGKKGMKFVFRSSDEDCK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtctcacctcctcttcctcctccgcgcccgctccgctccttccctctctcgct
gatcgaccgagcccgggaatcgcgggcgggggtggcaatgttcgcctgagcgtggtttct
tcgccgcgccggtcgtggcctggaaaggtcaagaccaatttctcagttcctgcgactgcg
cgaaaaaacaaaaccatggtgactgttgtggaggaggtcgaccaccttcctatatatgat
ctggaccctaagttggaggaattcaaggatcacttcaactataggataaaaagatacctc
gaccagaaatgcctgattgaaaaacatgaggggggccttgaagaattttctaaaggctat
ttgaagtttgggattaatacagttgatggtgccacaatatatcgtgaatgggcgcctgct
gcacaagaagcacagctcattggtgagttcaataactggaatggtgcaaaacacaagatg
gagaaggataaatttggcatttggtcaatcaagatttcacatgtcaatgggaagcctgcc
atccctcacaattccaaggttaaatttcgctttaggcatgggggtggagcatgggttgat
cgtattcccgcatggattcgttatgcaacttttgatgcctctaaatttggagctccatat
gatggtgtacactgggatcctccagcctgtgaaaggtacgtgtttaagcatcctcgacct
ccaaaacctgatgctccacgcatctatgaggctcatgtggggatgagtggtgaagagcca
gaagtaagcacatacagagaatttgcagacaatgtgttaccacgcatacgggcaaataac
tacaacacagttcagttaatggcaatcatggaacattcctactatgcttcttttgggtat
cacgtgacaaattttttcgcagtcagcagcagatcaggaacaccagaggatctgaaatat
cttgttgacaaggcacatagtttaggattacgagttctgatggatgttgtccatagccat
gcgagtaataatgtgaccgatggtctaaatggctatgacgttggacaaaacactcatgag
tcttattttcatacaggagataggggctaccataaactctgggatagtcgtctgttcaac
tatgccaattgggaggtcttaagatttcttctttctaatttgagatattggatggacgaa
ttcatgtttgatggcttccgatttgatggggttacatcaatgctataccatcaccatggt
atcaataagggatttactggaaactacaaggagtatttcagtttggataccgatgtggat
gcaattgtttacatgatgctcgcaaaccatttaatgcataaactcttgccggaagcaact
attgttgctgaagatgtttcgggcatgccagtgctttgtcggccagttgatgaaggtgga
gtagggtttgacttccgcctggcaatggccattcctgatagatggattgactacctgaag
aacaaagaggaccgcaaatggtcaatgagtgaaatagtgcaaactttgactaacaggaga
tatacagaaaaatgcattgcctatgccgagagccatgatcagtccattgttggtgacaag
actatagcatttctcttgatggacaaggaaatgtacactggcatgtcagacttgcagcct
gcttcacctaccatcaaccgtggcattgcactccaaaagatgattcacttcattacgatg
gcccttggaggtgatggctacttaaattttatgggcaatgagtttggccatccagaatgg
attgactttccaagagaaggcaacaactggagctatgataaatgcagacgtcagtggagc
cttgtcgacactgatcaccttcgatacaagtatatgaatgcatttgatcaagcaatgaat
gcactcgaggaggaattttccttcctgtcatcatcaaagcagattgttagcgacatgaac
gagaaagataaggttattgtctttgaacgtggagatttggtttttgttttcaattttcat
cccaacaaaacttacaagggttacaaagtcggatgtgacttgcccgggaagtacagagta
gctctggactctgatgctttggtctttggtggccatggaagagttggccatgatgtggat
cacttcacgtctcccgagggaatgccaggagtaccagaaacaaatttcaacaaccgccct
aactcattcaaagtcctttccccgccccgtacctgtgtggcttactatcgcgttgatgaa
gatcgtgaagagctcaggaggggtggagcagttgcttctggaaagattgttacagagtat
atcgatgttgaagcaacaagtggggagactatctctggtggctggaagggctccgagaag
gacgattgtggcaagaaagggatgaagtttgtgtttcggtcttctgacgaagactgcaaa
tga

DBGET integrated database retrieval system