KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0108300-01Help
Entry
Os07t0108300-01   CDS       T02163                                 

Gene name
Os07g0108300
Definition
(RAP-DB) Similar to Alanine aminotransferase.
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00220  Arginine biosynthesis
dosa00250  Alanine, aspartate and glutamate metabolism
dosa00260  Glycine, serine and threonine metabolism
dosa00630  Glyoxylate and dicarboxylate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
dosa01210  2-Oxocarboxylic acid metabolism
dosa01230  Biosynthesis of amino acids
Module
dosa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dosa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Os07t0108300-01 (Os07g0108300)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os07t0108300-01 (Os07g0108300)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os07t0108300-01 (Os07g0108300)
   00260 Glycine, serine and threonine metabolism
    Os07t0108300-01 (Os07g0108300)
   00220 Arginine biosynthesis
    Os07t0108300-01 (Os07g0108300)
Enzymes [BR:dosa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Os07t0108300-01 (Os07g0108300)
    2.6.1.4  glycine transaminase
     Os07t0108300-01 (Os07g0108300)
    2.6.1.44  alanine---glyoxylate transaminase
     Os07t0108300-01 (Os07g0108300)
Amino acid related enzymes [BR:dosa01007]
 Aminotransferase (transaminase)
  Class I
   Os07t0108300-01 (Os07g0108300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
RAP-DB: Os07t0108300-01
Position
chr07:complement(join(450959..451162,450757..450874,450492..450573,450297..450384,450025..450183,449125..449298,448707..448838,448052..448117,447516..447580,447274..447365,447026..447182,446619..446739))
AA seq 485 aa AA seqDB search
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

DBGET integrated database retrieval system