KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0108300-01Help
Entry
Os07t0108300-01   CDS       T02163                                 

Gene name
Os07g0108300
Definition
Similar to Alanine aminotransferase.
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os07t0108300-01 (Os07g0108300)
   01210 2-Oxocarboxylic acid metabolism
    Os07t0108300-01 (Os07g0108300)
   01230 Biosynthesis of amino acids
    Os07t0108300-01 (Os07g0108300)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Os07t0108300-01 (Os07g0108300)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os07t0108300-01 (Os07g0108300)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Os07t0108300-01 (Os07g0108300)
   00260 Glycine, serine and threonine metabolism
    Os07t0108300-01 (Os07g0108300)
Enzymes [BR:dosa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Os07t0108300-01 (Os07g0108300)
    2.6.1.4  glycine transaminase
     Os07t0108300-01 (Os07g0108300)
    2.6.1.44  alanine---glyoxylate transaminase
     Os07t0108300-01 (Os07g0108300)
    2.6.1.-  
     Os07t0108300-01 (Os07g0108300)
Amino acid related enzymes [BR:dosa01007]
 Aminotransferase (transaminase)
  Class I
   Os07t0108300-01 (Os07g0108300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(450959..451162,450757..450874,450492..450573,450297..450384,450025..450183,449125..449298,448707..448838,448052..448117,447516..447580,447274..447365,447026..447182,446619..446739))
AA seq 485 aa AA seqDB search
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

DBGET integrated database retrieval system