KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0160000-00Help
Entry
Os07t0160000-00   CDS       T02163                                 

Gene name
Os07g0160000
Definition
Similar to Ubiquitin carboxyl-terminal hydrolase.
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Os07t0160000-00 (Os07g0160000)
Peptidases [BR:dosa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Os07t0160000-00 (Os07g0160000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(3207122..3207234,3207320..3207550,3210364..3210490,3210577..3210636,3210716..3210808,3210921..3211217,3211298..3211609,3211705..3211962,3212075..3212223,3212318..3212950,3213215..3213488,3213584..3213694)
AA seq 885 aa AA seqDB search
MATAATAQASASSSTASTRGSPAASSSSHSAVCLVPFRWWARVREEAPPEGGVRYAATAA
ASPSSYYGLRLLHSFLHPDLVLRLERGGCRGTGAGAGGRSYALVPADELSRVLARQNSSL
ALHNKHSFAEDSAGAYPLVLRISVRETSILTVKISKKDNPVENYKRAYKIFNIDSQPVHV
WDFSGQTNLILMNEWNRSNHDCCHSELENILEVQVYAMSDSLTSKIGGTSKEYTEQSSAD
VNDMDVDLSYGSFGRSSSHGLIGLENLGNTCFMNSSIQCLAHTSKLVDYFLGDYDRDINR
TNPLGLNGELALAFGELLRRLWNTERKPVSPHHFKAKIACFAPQFSGFNQHDSQELLAFL
LDGLHEDLNQVKCKPYEEAKDASGRPDKEVADEYWSNHLARNDSVIVDTYHGQYKSTLTC
PTCSKTSVTFDPFMYLSLPVPSTAKRTMTVTVFSTDGSIEPISYDVTVPQFGSLNDLVQA
LSSACSLGDDEILLITEVYNNRILRYLEEPSDSVSLLRDGDKLAAFRLPRKYEKSPVVVF
THQYFDERSSIDNITPQMKEFEAPLLAVLPERANGLTLKNIYLKLLEPLRFSKSTSSLND
SGRCNSGCAAVMMDATPDSDSKFQSAPSENAPESSQSETIECQMTEGPSESNIGDTTDSD
REAHMEEFEFYLINGRGEFQQTRIQTDEVDLQTTPNRLLINVHWQQNAVGQYDTSMLKSL
PEIHKLELIPKGNEDSVALHGCLEAFLKEEPLGPEDMWYCPCCKKHQQAMKKLDLWRLPE
VLVIHLKRFSYTQFTRNKLETFVDFPISDLDLSSYIIDKSELSDCHYRLYAISNHYGNMG
GGHYTASIYHEEGKGWYKFDDECVRPITEDSIKTPAAYVLFYRRE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccaccgcccaggcctccgcctcctcctccaccgcctccacccgcggc
tcccccgccgcctcctcctcctcccactccgccgtctgcctcgtccccttcaggtggtgg
gcgagggtgagggaggaggcgccgccggaaggcggggtgaggtacgcggcgaccgcggcg
gcgtcgccctcgtcgtactacgggcttcgcttgctccacagcttcctccacccggatctc
gtgcttcgcctcgagcgcgggggttgccgcggcacgggtgccggcgccggggggcggagc
tacgcgctcgtgccggccgacgagctctcgcgtgtgctcgcgaggcaaaattctagtttg
gcattgcataataaacattcatttgctgaggatagtgctggtgcgtaccctttggtgctt
aggatatctgttcgagaaacaagcattttgactgtgaagatcagcaaaaaggacaatcca
gttgagaactataaacgggcatacaagatttttaatattgattctcaaccagttcatgtt
tgggatttttcaggccagacaaacctaatattaatgaatgagtggaataggtcaaatcat
gactgctgccactcagagctagagaatattcttgaagtgcaagtctatgcaatgtctgac
tccttaacttccaagattggtggaaccagcaaagagtatacagaacaatcttctgcagat
gttaatgatatggatgttgatttgtcctatggaagctttggaagatctagctcgcatggg
ctaattggattggaaaatcttgggaatacttgctttatgaacagttcaattcaatgtttg
gcccacacatcaaagcttgttgattatttcctaggagattatgacagggatataaatcgg
actaacccactaggactgaatggggaacttgctttggcatttggagaattattgaggaga
ttatggaacaccgagagaaaaccagtttcaccacatcactttaaggcaaagattgcttgt
tttgcccctcagttcagtggcttcaatcagcatgattcacaggagcttcttgctttctta
ttggatggcctccatgaagatcttaaccaggtcaagtgcaagccatatgaagaagctaag
gatgcaagtgggcgccctgacaaagaagtggctgatgagtactggagtaatcatttagct
cgaaatgactctgtaatagttgatacttaccatgggcagtacaaatctacattaacttgc
cctacttgcagtaaaacatctgtcacttttgacccatttatgtacttgtctttgcctgta
ccttccacggcaaagaggacaatgactgttacagttttcagcactgatggtagtatagag
ccaatctcatatgatgtcactgtgccacaatttgggagtcttaatgatcttgttcaggct
ttaagttctgcttgttcactgggagatgatgaaatcctgctgattacagaggtttataac
aaccgcatcctccgatacctcgaagagccttcagattcagtttcattgctgagggatgga
gataaattggcagcattccggctaccaagaaaatatgaaaaatccccagttgtggttttt
acacaccaatattttgatgagcgttctagtattgataatataacaccacaaatgaaggaa
tttgaggccccactgctggcagttcttcctgagagagccaatggattaactctgaagaat
atctacctgaagttgttggaaccattaagattttccaagagtactagttctcttaatgat
agtgggaggtgtaatagtggctgtgctgctgtcatgatggatgcaacgcctgattcagat
agtaagtttcagagtgctccatcggaaaacgcccctgaaagtagccagtctgagactatt
gaatgccaaatgaccgaaggacctagtgagtcaaatattggtgacactactgattctgat
cgggaggcacacatggaagagtttgaattttatttaataaatggaaggggtgaattccag
cagacgagaatacaaacagatgaggtggatttacagacaacaccaaaccggctacttatc
aatgtccattggcaacaaaatgcagtaggacaatatgacacctcaatgctgaaaagtcta
cctgagattcataagcttgagcttatcccgaaaggaaatgaagattctgtcgcactacat
ggttgtctggaagcctttctaaaagaggaaccgttgggcccagaagacatgtggtactgc
ccatgctgcaaaaagcatcaacaagcgatgaagaaattagatctgtggaggctaccggaa
gttcttgtcattcatctcaaaaggttctcgtacacccaattcacaagaaataagcttgag
acatttgtggatttccccattagtgatttggatctgtcatcatatatcattgacaagagt
gaactatcagactgccactatcgcttgtatgctattagcaatcactatggaaatatggga
ggtggacactacaccgccagcatctaccatgaagaagggaagggatggtataagtttgat
gatgagtgcgtgagacctataactgaagacagtataaagacacctgctgcttatgtgctg
ttctacagacgagaatga

DBGET integrated database retrieval system