KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0164100-01Help
Entry
Os07t0164100-01   CDS       T02163                                 

Gene name
Os07g0164100
Definition
Histone deacetylase superfamily protein.
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Os07t0164100-01 (Os07g0164100)
Protein phosphatases and associated proteins [BR:dosa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Os07t0164100-01 (Os07g0164100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(3443338..3443838,3443123..3443213,3442898..3442956,3442286..3442361,3441638..3441702,3441465..3441520,3441160..3441283,3440907..3441032,3440722..3440772,3440515..3440583,3440168..3440276,3439243..3439322,3438519..3438601,3438187..3438232,3437522..3437690,3436267..3436433))
AA seq 623 aa AA seqDB search
MASDMRSLNSQKGQSCGVSDQACHSKSKSGNDGKPSHAKANGVSSLSGSHNDEKILKENS
GACNLNSDHANPLSVDGTKVSTARSELIDSSGHDGCLHVKNESCMACDDLLQESDKEQPG
GTLEDLFSFNDEEDDDSDWEPSARLALSRWFCLNCTVPNMEGFTHCQNCDELKGSVVVGY
DAFKAHLAQAALLSADAALPSVSTAVGFDERMLLHSEIEIKPNPHPERPDRLRAIAASLA
AAGIFPSKCVMVPPREITKEELLRVHTSDHIDSVEQTKNMLYSYFTSDTYANGHSACAAK
LAAGICADLANLIVSGRVRNGFAMVRPPGHHAGVKQAMGFCLHNNAAVAALAAQRAGAKK
VLIVDWDVHHGNGTQEIFDGDNSVLYISLHRHEDGSFYPGTGAANEVGVMDGQGFSVNIP
WSRGGVGDNDYIFAFKHVVLPIAAEFAPDITIISAGFDAARGDPLGCCDVTPAGYSRMAS
MLTACSQGKLLVILEGGYNLRSISSSATEVVKVLLGDSPVYDTDATEPSEEGIQTVLQVL
SIQQQFWPVLVPSFASVLALQRSVFSRYTTEVNKMKRKHAGGAGPFWWKWGSKRLLYEVL
FEGRCLRKTKDTGKEKLNDEAEP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgatatgaggtcactcaacagccaaaagggacagagttgtggagtttcagac
caagcttgccacagcaaaagcaaaagcggcaatgatggaaaaccatcacatgctaaagca
aatggagtttcctcgttgagcgggagtcataatgatgagaaaattttgaaagagaactct
ggagcatgcaatttaaattccgaccatgccaatcctttatcagtagatgggaccaaagtt
tctacagcaaggtcggaacttattgacagttcaggccatgatggttgtctgcatgtcaag
aatgaaagctgtatggcttgtgatgatctgcttcaagagtctgacaaagaacagcctggg
ggtacactggaggatctattttcctttaatgatgaagaggatgatgacagtgactgggaa
ccctctgctcgccttgctttgagcaggtggttttgcttgaactgtacagtgccaaacatg
gaggggtttacacattgtcagaattgcgatgagcttaagggatctgtggtagttggatat
gatgctttcaaagctcatcttgcacaggcagctttgttatctgctgacgcagcgctgcca
tcagtatctacagctgtcggttttgatgaaagaatgttgctccatagtgagatagagatt
aaaccaaatccacatccagaaaggcctgaccgccttcgtgcaatcgctgccagtcttgct
gctgcaggtatcttcccttcaaaatgtgtcatggtacctcctcgagaaatcactaaggaa
gaactcctaagggtccatacttcagatcacattgacagtgttgagcagacaaagaacatg
ctttacagttacttcacttcagatacctatgcaaatggacactcagcatgtgctgccaaa
cttgcagcagggatatgtgctgatcttgctaacttgatagtatctgggcgtgttcgcaat
ggatttgcaatggtgagacctcctggccatcatgcaggggtgaaacaagccatgggtttt
tgtcttcacaataatgcagcagtggctgcattagctgcacaaagagctggtgccaagaaa
gtcttaatagttgactgggatgtccaccatggcaatggaacacaggagatatttgatggg
gacaattctgtcttgtacatatcattacatcggcatgaggatggaagcttctaccctgga
actggggcagcaaatgaggtgggagttatggatggccaaggattctcagtcaatatacct
tggagccgtggtggtgttggagacaatgactacatatttgcttttaagcatgtggtgctt
ccgatagctgcagaatttgctccagacatcaccatcatatctgcaggatttgatgcagcg
aggggtgaccctctgggttgttgtgatgtcacacctgctggatattctaggatggcgtcc
atgctaactgcttgttcacagggaaaattgttggttatacttgagggaggatacaatctt
cggtctatatcctcatcagctactgaagttgttaaggtcctacttggggatagtcctgtt
tatgatacagatgcaactgaaccatcagaggagggcatacagactgtcttacaagtcctg
agtatccagcagcaattttggccagttttagttccatcctttgcatcagttctggcactg
cagcggtcggttttttccagatataccactgaagtaaacaagatgaaaaggaagcatgca
ggaggggcaggacccttctggtggaaatgggggagtaaaaggctactgtacgaagtgcta
tttgagggccgctgtctgaggaaaaccaaggatacaggcaaagaaaaattgaatgatgaa
gcagagccctaa

DBGET integrated database retrieval system