KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0182100-01Help
Entry
Os07t0182100-01   CDS       T02163                                 

Gene name
Os07g0182100
Definition
(RAP-DB) Similar to Tryptophan synthase alpha chain.
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00260  Glycine, serine and threonine metabolism
dosa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01230  Biosynthesis of amino acids
Module
dosa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os07t0182100-01 (Os07g0182100)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Os07t0182100-01 (Os07g0182100)
Enzymes [BR:dosa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Os07t0182100-01 (Os07g0182100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth NanE PcrB FMN_dh TMP-TENI IGPS Spore_YtrH Ribul_P_3_epim
Motif
Other DBs
RAP-DB: Os07t0182100-01
Position
chr07:complement(join(4333325..4333564,4332546..4332692,4332264..4332438,4331798..4331874,4331400..4331477,4331076..4331153,4330920..4330979,4330691..4330825))
AA seq 329 aa AA seqDB search
MAFALKASTASAAAASTASASASSLSVAAAAPGRRGGAAGRVSFRGVPAPMVAIRAEAAA
VGEDERVISGTFAKLKEQGKTAFIPFITAGDPDLATTAKALKILDACGSDLIELGVPYSD
PLADGPVIQASATRALSKGTTFEDVISMVKEVIPELSCPVALFTYYNPILKRGIANFMTV
VKEAGVHGLVVPDVPLEETNILRSEAAKNNLELVLLTTPTTPTERMEKITKASEGFIYLV
STVGVTGARANVSGKVQSLLQDIKQVTDKAVAVGFGISTPEHVKQIAGWGADGVIIGSAM
VRQLGEAASPEEGLKKLEELAKSLKAALP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggcctcaactgcctccgccgcggcggcgtccacggcctcggcc
tcggcctcgtccctgtccgtggctgcggccgcgcccgggaggcgcggcggcgcggcgggg
agggtctcgttccgcggggtccctgctcccatggtggcgatcagggcggaggcggctgcc
gtcggggaggacgagcgcgtcatctccggcaccttcgccaagctcaaggagcaggggaag
accgcattcattccattcatcactgctggtgaccctgacttggcgactacagcgaaagcg
ttgaagattcttgatgcttgtggttcggatctgatcgaattgggcgtgccttactctgac
ccattggctgatggccccgtcattcaggcttctgctacacgtgcactatcaaaaggcacc
acatttgaggatgttatctctatggtaaaggaggtgatacctgagctgtcctgccctgta
gcgcttttcacatattataacccgattctgaagcgtggcatcgcaaacttcatgactgtt
gtaaaagaagccggtgtccatggtcttgtggtacctgatgttcctctggaagagacaaat
attttgaggagtgaagctgctaagaacaaccttgagctggtgctactgacaacaccaact
acaccaacagaaagaatggagaaaattacaaaagcttctgaaggatttatttatcttgta
agcactgttggagttacaggtgcacgtgcaaatgtcagtggcaaggtgcaatctcttctc
caggatatcaagcaggtcacggacaaagctgtggctgttgggttcggtatatcgactcca
gagcatgtgaagcagattgcgggatggggcgcagatggtgtgatcattgggagcgctatg
gtgaggcaattgggcgaagctgcttcacccgaagaaggattgaagaagctagaagagcta
gccaagagcctgaaggctgcattgccctga

DBGET integrated database retrieval system