KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0182100-01Help
Entry
Os07t0182100-01   CDS       T02163                                 

Gene name
Os07g0182100
Definition
Similar to Tryptophan synthase alpha chain.
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dosa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dosa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:dosa00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(4333325..4333564,4332546..4332692,4332264..4332438,4331798..4331874,4331400..4331477,4331076..4331153,4330920..4330979,4330691..4330825))
AA seq 329 aa AA seqDB search
MAFALKASTASAAAASTASASASSLSVAAAAPGRRGGAAGRVSFRGVPAPMVAIRAEAAA
VGEDERVISGTFAKLKEQGKTAFIPFITAGDPDLATTAKALKILDACGSDLIELGVPYSD
PLADGPVIQASATRALSKGTTFEDVISMVKEVIPELSCPVALFTYYNPILKRGIANFMTV
VKEAGVHGLVVPDVPLEETNILRSEAAKNNLELVLLTTPTTPTERMEKITKASEGFIYLV
STVGVTGARANVSGKVQSLLQDIKQVTDKAVAVGFGISTPEHVKQIAGWGADGVIIGSAM
VRQLGEAASPEEGLKKLEELAKSLKAALP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgcgctcaaggcctcaactgcctccgccgcggcggcgtccacggcctcggcc
tcggcctcgtccctgtccgtggctgcggccgcgcccgggaggcgcggcggcgcggcgggg
agggtctcgttccgcggggtccctgctcccatggtggcgatcagggcggaggcggctgcc
gtcggggaggacgagcgcgtcatctccggcaccttcgccaagctcaaggagcaggggaag
accgcattcattccattcatcactgctggtgaccctgacttggcgactacagcgaaagcg
ttgaagattcttgatgcttgtggttcggatctgatcgaattgggcgtgccttactctgac
ccattggctgatggccccgtcattcaggcttctgctacacgtgcactatcaaaaggcacc
acatttgaggatgttatctctatggtaaaggaggtgatacctgagctgtcctgccctgta
gcgcttttcacatattataacccgattctgaagcgtggcatcgcaaacttcatgactgtt
gtaaaagaagccggtgtccatggtcttgtggtacctgatgttcctctggaagagacaaat
attttgaggagtgaagctgctaagaacaaccttgagctggtgctactgacaacaccaact
acaccaacagaaagaatggagaaaattacaaaagcttctgaaggatttatttatcttgta
agcactgttggagttacaggtgcacgtgcaaatgtcagtggcaaggtgcaatctcttctc
caggatatcaagcaggtcacggacaaagctgtggctgttgggttcggtatatcgactcca
gagcatgtgaagcagattgcgggatggggcgcagatggtgtgatcattgggagcgctatg
gtgaggcaattgggcgaagctgcttcacccgaagaaggattgaagaagctagaagagcta
gccaagagcctgaaggctgcattgccctga

DBGET integrated database retrieval system