KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0410100-01Help
Entry
Os07t0410100-01   CDS       T02163                                 

Gene name
Os07g0410100
Definition
Similar to Dihydrolipoamide S-acetyltransferase (EC 2.3.1.12).
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os07t0410100-01 (Os07g0410100)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os07t0410100-01 (Os07g0410100)
   00020 Citrate cycle (TCA cycle)
    Os07t0410100-01 (Os07g0410100)
   00620 Pyruvate metabolism
    Os07t0410100-01 (Os07g0410100)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Os07t0410100-01 (Os07g0410100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(12819063..12819098,12818631..12818724,12817664..12817737,12817486..12817580,12817052..12817092,12816240..12816295,12815797..12815871,12815576..12815668,12815206..12815454,12815040..12815112,12813864..12813940,12813691..12813776,12813477..12813552,12813261..12813328,12813116..12813182,12812958..12813053,12812776..12812878,12812344..12812439,12812185..12812255))
AA seq 541 aa AA seqDB search
MSAAHLLRHSRKLRSLHNALDCERSGLVRYFSTASGSFPTKGNGAEKRIGGARFPQRKQP
GKELETSKLSLGLNGSYTCRRSPNNFIPNTITGLNGSLSCGQIASARSFSSSADLPPHQE
IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG
SKEIKVGEIIAVTVEEEGDIKKFKDYKPSTLAAPVAPSELKAQSEPTEPKVEEREPSKAS
ELKAPRTEEPSRSGDRIFSSPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLAKGCR
KEALAAPGLSYTDVPNAQIRKVTANRLLSSKQTIPHYYLTVDTRVDNLIKLRGELNPLQE
SSGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVIR
DADKKGLGMIAEEVKQLAQRARDNSLKPDDYEGGTFTISNLGGPFGIKQFCAIINPPQSA
ILAIGSAERRVIPGSANGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYIENPTSML
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcgcatctcctccgccactctcgcaagttgcggagtttacacaatgctcta
gactgtgagcgttctggcctcgtgcgctacttctccactgcttctggttcgttccccacc
aagggaaatggtgctgagaaaagaattggaggtgccagatttcctcagcgcaagcaacct
ggaaaagagcttgagacctccaagttgtcactaggacttaatggaagctacacttgcagg
agatcacctaacaactttatcccaaatactattactggtctcaatggttcattgtcatgt
ggacagatagcttcagcaagatctttctcaagcagtgcagacctgccaccacatcaggaa
atagggatgccatcactctctcctacaatgaccgaggggaacattgcaaggtggctgaag
aaggaaggagataaggtctcacctggtgaagttctttgtgaggtggagactgataaagcc
accgtagaaatggagtgcatggaagagggctatcttgctaagatcattcatggagatggt
tccaaagagatcaaagttggtgagattattgctgtaaccgtggaagaagagggtgacatc
aagaagtttaaggattataaaccttcaactttggctgcacctgtagccccttctgaactg
aaggctcagtctgagcctacagaaccaaaggtggaggaaagagagccttccaaagcatct
gagctaaaggccccaaggactgaagaaccttcgcggtcaggagatcgaatattctccagc
cctcttgctagaaaattggcggaagataacaatgttccactgtcgagtgtaaagggaact
ggtcctgatgggcgcattttgaaggcagacattgaagattacttggctaagggttgcaga
aaggaagctcttgcggctccagggctaagttacaccgatgttcccaatgcacaaataaga
aaggttactgcgaaccgcctgctaagctctaagcaaacaattccacattattacctgaca
gttgacacacgtgttgataatctcatcaagttgcgaggggaactgaatccattgcaggag
tcctccggtggtaagaagatatctattaatgatctagttataaaggctgcagctctggct
cttcgaaaggtccctcagtgtaatagctcctggatgaatgattttatccgccaataccac
aacgtgaacatcaatgttgctgtacagactgagcatggactgtttgttccagtaatcagg
gatgcagacaagaaaggacttggtatgattgcggaggaggtgaagcagttggctcaaaga
gcaagggataacagtttgaaaccagatgattatgagggaggcacattcaccatatcaaac
ttgggaggtccttttggaattaagcaattttgtgccatcataaatcctcctcagtcggca
atcttggccattggttctgctgagaggagggtgatacctggcagcgccaatggtcaatac
gagtttggttccttcatgtcggcaacaatgagctgtgatcacagggttattgatggtgca
atcggggcagaatttctgaaagcattcaagggctatatcgagaatccaacctcaatgtta
ctgtga

DBGET integrated database retrieval system