KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0452100-00Help
Entry
Os07t0452100-00   CDS       T02163                                 

Gene name
Os07g0452100
Definition
Similar to Alpha-galactosidase.
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dosa00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dosa00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dosa00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dosa00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(15580083..15580252,15580388..15580446,15581386..15581442,15581552..15581584,15581742..15581847,15581941..15582016,15582225..15582283,15582382..15582447,15582951..15583034,15583187..15583251,15583337..15583419,15583528..15583618,15583721..15583773,15583864..15584007,15584141..15584254)
AA seq 419 aa AA seqDB search
MGSYALPRRSLVLFLLSAAAVASTAAWAAASSAAGGGDDAARRSLLDNGLGRTPQMGWNS
WNHFGCNINENTIRSTVDALISTGLTKAGYTYVNLDDCWADYQRTKEGYIAADPKKFPSG
IKALADYVHSKGLKLGIYSSAGSRTCSKTMPGSLGYEDIDAKTFASWGVDYLKYDNCNSD
GSSETVRFPKMSFALRKTGRPIFYSICEWGQRNVATWGGQYGNSWRTTGDINDSWASMLS
NIDSNDASASYAKPGGWNDPDMLEVGNGGMTNDEYVVHISLWAIAKAPLIIGCDVRSISR
ETMEILSNPEVIAINQDPLGVQGKKVRKYDNEIEVWAGPLSQQRTAVLLLNRGATGSRQI
TAAWQDIGVGPGVAVEAKNVWLHATAPGRFTGSLTAEVAAHSCKLFVLTPVGRASEERS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggctcctacgctttgccacggcggtctctcgtcctcttcctcctctccgccgccgcc
gtcgcgtcgacggcagcatgggctgccgcttcgtcggcggccggcggtggtgatgatgcc
gctcgccgcagcctcctcgacaacgggctcgggcggacgccgcagatggggtggaacagt
tggaatcatttcgggtgcaacatcaacgagaacaccatccggagcaccgttgacgcactc
atctccaccgggctcacgaaggctggatacacttatgtcaacttagatgattgctgggca
gattaccaaaggaccaaagagggttacatagctgctgatccaaagaagttcccttcgggg
attaaggcactcgcagattatgtgcacagcaaggggcttaaactaggcatatactcttca
gccggctcaagaacttgcagcaaaacgatgcccggatctctgggctacgaggacatcgat
gctaagacatttgcatcatggggtgtggattacttgaagtacgacaactgcaacagtgac
ggctcgagcgaaaccgtcagattccccaagatgtctttcgctctgagaaaaaccggacgt
ccgatcttctactcgatctgcgaatggggccagaggaatgtggcgacgtggggtggccag
tacggcaacagctggaggaccaccggcgacatcaatgactcatgggccagcatgctgagc
aacatcgacagcaacgacgcctccgccagctacgccaagcccggcggctggaacgatcct
gacatgctggaggtcggcaatggagggatgacgaacgacgagtacgtcgtgcacatcagc
ctttgggcgattgccaaggctcctctgatcatcgggtgcgacgtgaggagtatctccagg
gagacgatggagatcctctccaaccctgaagtcatcgccattaaccaagatccattgggc
gtccagggaaagaaagtcaggaagtacgacaacgaaatcgaggtatgggcagggccgctc
tcccagcagaggacggcggtgctgctgctgaaccgcggcgccacgggcagccggcagatc
acggcggcgtggcaggacatcggcgtcggccccggcgtcgccgtcgaggcgaagaacgtc
tggctgcacgcgacggcgccggggaggttcaccggcagcctgacggcggaggtggcggcg
cactcgtgcaagctcttcgtcctcacgcccgtcggccgggccagcgaggagcggagctag

DBGET integrated database retrieval system