KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0493400-01Help
Entry
Os07t0493400-01   CDS       T02163                                 

Gene name
Os07g0493400
Definition
Similar to predicted protein.
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Os07t0493400-01 (Os07g0493400)
    1.3.1.94  polyprenol reductase
     Os07t0493400-01 (Os07g0493400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
chr07:join(18427906..18428112,18428715..18429061,18429538..18429772,18430208..18430303,18430971..18431042,18431175..18431279)
AA seq 353 aa AA seqDB search
MESEGWPALQPLLCFAWIAATLPIIAAALPIPTAVGGHLLRRLLSAFSSRGKTVRPSPAS
SSGSSSSKAKFTVPQKYFMHFYVVGVLATTILLLAIWFYAYMKLTPLLLESSSYSTIFSH
LVGSNSFSFGRVRSRTMGHKYRVWRTVFALLLMEVQVLRRLYETEHVFHYSPARMHIVGY
LTGLFYYVAAPLSLASSCIPEAAEYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGW
TQWIGAVIFIWGSLHQIRCHAILGSLREHKDYDEYVIPCGDCFNRVSCPHYLAELVIYFG
MLVASGAEDIPVWFLFIFVITNLSFAAVETYNWYLQKFEDYPRSRYAIIPFVC
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgagggctggcctgccctccagcctctgctgtgcttcgcctggatcgccgcc
acactccccatcattgccgctgcgctgccaatccccacggccgttggaggtcacctcctt
cgccggctgctctcggccttctcctcccgcggcaagaccgtgaggccctcccccgcctca
tcctctggttcctcctcttctaaggcgaagttcactgttccacaaaaatacttcatgcat
ttttatgtggtcggagtgctggcgacaacaattttgcttctggcaatatggttctatgca
tatatgaaattgacaccattattgcttgagtcatcaagttattccacaattttcagtcat
cttgtaggctcaaattcattctcttttggtcgtgttcgctcgcgcaccatgggacacaag
tatcgtgtctggcgaacagtatttgcacttctattgatggaagttcaagtgctgagacga
ctatatgagactgaacatgtgttccactacagtcctgctcggatgcatattgtaggatat
ttgacaggtctattctactatgtagctgcaccattatctctcgctagctcttgtattcct
gaagcagcagagtattttcaaggtcaagtacctgagttcgtagtaaagggtcgtgcgaga
atgccagatctagtaattgattcatcatctctactacagcctcttctaaagttggggtgg
acccagtggataggtgctgttatattcatttggggttccctccatcagatccgttgccat
gcaattcttggatcgttgcgtgaacacaaagattatgatgaatatgtaattccttgtggt
gactgctttaatcgggtctcttgtcctcattaccttgctgaactagtaatatattttggc
atgttggttgctagtggtgcagaagacattccagtgtggttcctgttcatatttgtgatc
acgaacctgtcatttgcagcagtagaaacttacaattggtatcttcaaaagtttgaagac
tatcctcgctctcgctatgctatcattccatttgtatgctag

DBGET integrated database retrieval system