KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0529000-01Help
Entry
Os07t0529000-01   CDS       T02163                                 

Gene name
Os07g0529000
Definition
Similar to Isocitrate lyase (Fragment).
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Os07t0529000-01 (Os07g0529000)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Os07t0529000-01 (Os07g0529000)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Os07t0529000-01 (Os07g0529000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(20693417..20693446,20691732..20693335,20691510..20691594))
AA seq 572 aa AA seqDB search
MSSPFSVPSLIMEEEGRFEAEVAEVEAWWGTDRFRLTKRPYTARDVALLRGTLRQSYASG
DMAKKLWRTLRAHQANGTASRTFGALDPVQVAMMAKHLDTVYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQLYHDRKQREARMSMSRAERAHEPYVDYLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHLEDQSSVTKKCGHMAGKVLVAVSEHVNRLVAARLQFDI
MGVETVLVARTDAVAATLIQTNVDARDHQFILGATNPRLRNRSLAAVLSDAMSAGKNGRE
LQAIEDEWLATAQLKTFSDCVRDAIASLNATDADKQRKLQEWSAATSHDKCVPLEQARDI
AAGLGVTSLFWDWDLPRTREGFYRFRGSVAAAVVRGRAFAPHADVLWMETSSPNIAECTA
FAEGVRAASPGAMLAYNLSPSFNWDASGMTDADMSEFIPRVARLGYVWQFITLAGFHADA
LVTDTFARDFARRGMLAYVERIQREERSNGVETLQHQKWSGANFYDRVLKTVQGGISSTA
AMGKGVTEEQFKGSWTGPGSESSSHVLAKSRM
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccgttctccgtgccatctctgatcatggaggaggaagggcggttcgaggcg
gaggtggcggaggtggaggcgtggtggggaacggacaggttccggctcaccaagcgcccc
tacacggcgcgcgacgtcgcgctcctccgcggcacgctccggcagagctacgcctccggc
gacatggccaagaagctgtggcgcacgctcagggcgcaccaggccaacggcacggcgtcg
cgcaccttcggcgcgctcgaccccgtccaggtcgccatgatggcgaagcacctcgacacc
gtctacgtctccggatggcagtgctcgtcgacgcacacctcgacgaacgagccgggcccc
gacctcgccgactacccctacgacaccgtccccaacaaggtcgagcacctcttcttcgcc
cagctctaccacgaccgcaagcagcgggaggcgcgcatgtcgatgtccagggcggagcgc
gcgcacgagccgtacgtggattatcttaagcccatcatcgccgacggcgacaccgggttc
ggcggcgccacggccaccgtcaagctgtgcaagctgttcgtcgagcgcggggcggccggg
gttcacctcgaggaccagtcgtcggtgaccaagaagtgcgggcacatggcggggaaggtg
ctcgtcgccgtctccgagcatgtcaaccgcctcgtcgccgcgcggctccagttcgacatc
atgggcgtcgagaccgtcctcgtcgcgcgcaccgacgccgtcgccgccacgctgatccag
accaacgtcgacgcgcgcgaccaccagttcatcctcggcgcgaccaacccgcgcctcagg
aaccggagcctcgccgccgtcctctccgacgccatgtcggcgggcaagaacggcagggag
ctccaggccatcgaggacgagtggctcgccacggcgcagctcaagaccttctctgactgc
gtcagggacgccatcgcgagcctcaacgccaccgacgccgacaagcagcgcaagctccag
gagtggagcgccgccaccagccacgacaagtgcgtgcccctcgagcaggcgcgcgacatc
gccgcgggcctcggcgtcacatccctgttctgggactgggacctgccgagaacacgggag
gggttctaccgcttccgcggctccgtcgcggcggccgtcgtccgcggccgcgcgttcgcg
ccgcacgccgacgtgctctggatggagacgtcgagccccaacatcgccgagtgcacggcg
ttcgccgagggcgtgagggcggcgagcccgggcgcgatgctggcgtacaacctctcgccg
tccttcaactgggacgcctccggcatgacggacgccgacatgtcggagttcatcccgcgc
gtggcgaggctggggtacgtgtggcagttcatcacgctcgccgggttccacgccgacgcg
ctcgtcacggacacgttcgcccgcgacttcgcgcggcgcggcatgctggcgtacgtggag
aggatccagagggaggagaggagcaacggcgtggagacgctgcagcaccagaagtggtcg
ggcgccaacttctacgacagggtgctcaagaccgtgcagggtggcatctcctctaccgcc
gccatgggcaaaggagttactgaagagcagttcaagggctcatggacagggcctggaagt
gagagcagcagccatgttcttgccaaatccaggatgtga

DBGET integrated database retrieval system