KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0558200-01Help
Entry
Os07t0558200-01   CDS       T02163                                 

Gene name
Os07g0558200
Definition
Inositol monophosphatase family protein.
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Os07t0558200-01 (Os07g0558200)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Os07t0558200-01 (Os07g0558200)
Transfer RNA biogenesis [BR:dosa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Os07t0558200-01 (Os07g0558200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(22308509..22308618,22308271..22308403,22307036..22307138,22306712..22306947,22306562..22306621,22305426..22305808,22305004..22305079,22304858..22304908,22304602..22304745))
AA seq 431 aa AA seqDB search
MPLLHLSPPPHRLLLAGGGRRRLLLPAARRRSLVRVRAAASAAAAAAEAYGLPFPPERAA
HHRELAAAAAAVERACRLCVDVKRTLLSGDKKILEKNDQTPVTVADFGVQALISLELQRL
FPSIPLVAEEDSASLRSSNTDDNSSNVLVESISSAVAEKVSNANSLLTHDDVLRAIDRGG
KNAVSFDSNPASYWVLDPIDGTKGFLGGDDALYVVGLALVVNEKVVAGVMGCPNWSNATI
ASRKEDSAAAQPDHGILMIAHVGCGTWSRHLSVDIGQFTTAQSTWNRCLVDSCSVVNMAR
FCIPDSQTWNMIPLSVLFNSTMDESNPRDENEILLLSVYCGSLCKYLTVASGRASVFVLR
ARTKNLKSWDHAVGVICVQEAGGQISDWSGKPLDLAADLTGRRDIYPSGGVLVTNGALHG
KLVEMISANHK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctccacctctcgccgccgccgcaccgcctcctcctcgccggcggcggccgc
cgccgcctactcctcccggcggctcgccgccgctccctcgtccgcgtcagggcggcggcg
tcggcggccgcggccgcggcggaggcgtacgggctacccttccctcctgagcgcgccgcc
caccaccgggagctcgcggcggccgccgcggccgtcgagcgcgcctgccgcctctgcgta
gacgtgaagagaacgctgctttcgggtgacaagaagattcttgaaaagaatgaccaaact
cctgtcacagttgcagattttggagtacaagctcttattagtttagagctccagcgattg
tttccgtcaatacctctggtggcagaagaggattcagcttctctgaggtcatccaatact
gatgataacagtagtaatgttcttgttgagtcaatttcaagtgctgttgcagaaaaagtg
agtaacgccaattcacttttaactcatgatgatgtgctgagagctattgatagaggaggc
aagaatgctgtatcctttgattcaaatcctgctagttattgggtacttgatccaattgat
ggcacaaaaggtttcttgggaggggacgatgctctgtatgtggtggggctggctcttgtg
gtaaatgaaaaggtagtagcaggagtgatgggatgtcctaattggtctaatgctaccata
gccagcagaaaagaagacagcgctgctgcccaacctgatcatgggatccttatgattgct
catgtgggctgtggaacttggtctaggcatttgtctgtcgatattggccagttcactacg
gcacagagtacttggaatagatgcttagtggattcttgttcagttgtgaacatggcacgc
ttttgcattcctgatagccaaacctggaatatgataccgctatctgttctcttcaactca
acaatggatgaatccaatcctagagatgagaatgaaattctcctcttatctgtttactgt
ggcagcttgtgcaagtacctaactgtagcttctgggagagcctccgtttttgtacttcga
gcacggacgaaaaatctcaagtcttgggatcatgctgtcggagtaatttgtgtacaggaa
gctggaggtcagattagtgactggagtgggaaaccgttggatcttgcagctgacctaact
gggcgcagagacatttacccttcaggtggtgttctcgtcaccaacggtgctctgcacggc
aagctggttgaaatgatctcagcaaatcacaagtag

DBGET integrated database retrieval system