KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0575500-00Help
Entry
Os07t0575500-00   CDS       T02163                                 

Gene name
Os07g0575500
Definition
Similar to beta-hexosaminidase.
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Os07t0575500-00 (Os07g0575500)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Os07t0575500-00 (Os07g0575500)
   00603 Glycosphingolipid biosynthesis - globo series
    Os07t0575500-00 (Os07g0575500)
   00604 Glycosphingolipid biosynthesis - ganglio series
    Os07t0575500-00 (Os07g0575500)
   00511 Other glycan degradation
    Os07t0575500-00 (Os07g0575500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Os07t0575500-00 (Os07g0575500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(23275743..23276634,23274457..23275400))
AA seq 611 aa AA seqDB search
MSTNQGVQLRLAAQAKAAMATKNGGFVALLLLLSFLLSSPLPARCDAPLPVNVWPKPTSM
SWAEPHMAVRVSSSFHVVAPSGNAHLLSAARRYAALLLAERYRPLVTPAVNVTAGGAGAG
AAGRGAELGYLTLAVSDLHAPLQHGVDESYALEILPAGAAATVTAATAWGAMRGLETFSQ
LAWWCGRERAVLVAAGVRVEDRPLYPHRGLMLDTGRTYFPVADILRTIDAMAANKMNVFH
WHITDSQSFPLELPSEPALAEKGSYGDGMRYTVDDVKLIVDFAMNRGVRVVPEIDTPGHT
ASWAGAYPELVSCAGEFWLPDASDWPSRLAAEPGAGQLNPLEPKTYQVMSNVINDVTSLF
PDGFYHAGADEVTPGCWNADPSIQRYLARGGTLSRLLEKFVGAAHPLIVSRNRTAVYWED
VLLDQAVNVTASAIPPETTILQTWNNGGNNTRLIVRAGYRAIVSSASFYYLDCGHGDFAG
NDSAYDDPRSDYGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDA
AVLDGRVWPRASAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWC
RNRPGMCNLVR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaatcagggggtgcagctccgattagcggctcaagctaaggcagccatggca
accaagaacggtggttttgttgcgttgctgctgctgctgtcgttcttgctgagctcgccg
ctgccggcgcgatgcgacgcgccgctccccgtcaatgtctggcccaagccgacgtccatg
tcgtgggcggagccccacatggccgtgcgtgtctcgagctcgttccacgtcgtcgccccg
tccgggaacgcgcacctcctctcggcggcgcggcgctacgccgcgctgctcctcgccgag
cggtaccggcccctcgtgacgccggcggtgaacgtcaccgcgggcggcgccggcgccggc
gcggcgggaaggggagccgagctggggtacctgacgctcgccgtgtccgacctgcacgcg
ccgctgcagcacggcgtggacgagtcgtacgcgctggagatcctccccgccggcgcggcg
gccacggtgaccgcggccacggcgtggggcgccatgcgcggcctcgagacgttctcgcag
ctggcgtggtggtgcgggcgggagcgggcggtgctggtggccgccggcgtgcgcgtcgag
gaccggccgctgtacccgcaccgcgggctgatgctggacaccgggaggacgtacttcccc
gtcgccgacatcctccggacgatcgacgccatggcggcgaacaagatgaacgtgttccac
tggcacatcacggactcccagtcgttccccctcgagctcccctccgagccggcgctcgcc
gagaagggctcctacggcgacggcatgcgctacaccgtcgacgacgttaagctcattgtc
gacttcgccatgaaccgcggcgtccgcgtcgtgccagagatagacacacccggccacacg
gcgtcgtgggccggagcttaccccgagctggtgtcctgcgccggcgagttctggctgccc
gacgcgtctgactggcccagccgacttgccgccgagccgggcgccggccagctcaacccg
ctggagcccaagacgtaccaggtgatgtccaacgtcatcaacgacgtcacctccctcttc
ccggacggcttctaccacgccggcgccgacgaggtcacgccggggtgctggaacgccgac
ccgtccatccagcgctacctcgcccgcggcggcacgctcagccgcctcctcgagaagttc
gtcggcgcggcgcacccgctgatcgtgtcccggaaccggacggcggtgtactgggaggac
gtgctgctggaccaggcggtgaacgtgaccgcgtcggcgatcccgccggagacgacgatc
ctgcagacgtggaacaacggcggcaacaacacgaggctgatcgtgcgcgccgggtaccgg
gccatcgtctcgtcggcgtcgttctactacctcgactgcggccacggcgacttcgccggc
aacgactccgcctacgacgacccgaggagcgactacggcaccagcggcgggtcgtggtgc
ggaccgtacaagacgtggcagcgggtgtacgactacgacgtcgcgggcgggctcaccgcc
gaggaggccaggctggtggtcggcggggaggtggcgatgtggacggagcaggtggacgcg
gcggtgctcgacggcagggtgtggccgagggcgtcggcgatggcggaggcgctgtggtcg
ggcaaccgcgacgccaccggccggaagcgctacgccgaggcgaccgaccggctcaccgac
tggcggcaccggatggtggggcgaggggtccgcgcggagcccatccagccgctctggtgc
aggaaccgcccgggaatgtgtaacttggtccggtga

DBGET integrated database retrieval system