KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0607400-01Help
Entry
Os07t0607400-01   CDS       T02163                                 

Gene name
Os07g0607400
Definition
Pectin lyase fold/virulence factor domain containing protein.
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Os07t0607400-01 (Os07g0607400)
   00500 Starch and sucrose metabolism
    Os07t0607400-01 (Os07g0607400)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Os07t0607400-01 (Os07g0607400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(24963775..24964112,24963429..24963618,24963122..24963328,24961875..24962114))
AA seq 324 aa AA seqDB search
MAATGVLVVVVALVFAVTVAGGGGAGVGGDGGFITWEDLSMPAGAARSSTWDDTAGGGGG
KRSGGGGGGEQRTTIVVSPDGTGHSRTVQGAVDMVPAGNTRRVKIVVRPGVYREKVTVPI
TKPFVSLIGMGTGHTVITWHSRASDVGASGHQVGTFYSASVAVEADYFCASHITFENSAA
AAAPGAVGQQAVALRLSGDKTVLYKCRILGTQDTLFDNIGRHYLYNCDIQGSIDFIFGNA
RSLYQGCTLHAVATSYGAIAASQRSSPSEESGFSFVGCRLTGSGMLYLGRAWGKYSRVVY
SYCDLSGIIVPQGWSDWGDQSRTK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgccacgggcgtgctcgtcgtcgttgtggcgctcgtgttcgccgtgacggtggct
ggcggcggcggcgccggagtaggaggtgatggcgggttcatcacgtgggaggacctgagc
atgccggccggggcggcgcggagcagcacgtgggacgacacggccggcggtggcggcggc
aagaggagcggcggcggcggcggcggcgagcagcggacgacgatcgtggtgtcgccggac
gggacggggcactcgcgcaccgtgcagggcgccgtcgacatggtccccgccggcaacacg
aggagggtcaagatcgtcgtcaggccgggcgtctacagggagaaggtgacggtgccgatc
acgaagccgttcgtgtcgctgatcggcatgggcaccggccacacggtgatcacgtggcac
tcgcgcgcgtccgacgtcggcgcgtcgggccaccaggtgggcaccttctactccgcctcc
gtcgccgtcgaggccgactacttctgcgccagccacatcaccttcgagaactcggcggcg
gcggcggcgccgggggcggtggggcagcaggcggtggcgctgaggctgtccggcgacaag
acggtgctgtacaagtgcaggatactggggacgcaggacacgctgttcgacaacatcggg
aggcactacctctacaactgcgacatccagggctccatcgatttcatctttggcaacgca
aggtccttgtaccagggttgcacgctgcacgccgtggcgacgagctacggcgcgatcgcg
gcgtcgcagcggagctcgccgtcggaggagtccgggttcagcttcgtcggctgccggctc
accggctccggcatgctctacctgggaagagcatggggcaagtactccagagtggtgtac
tcctactgtgacctcagtggcatcatcgtcccccagggatggagcgactggggtgatcaa
tcaagaacaaagtga

DBGET integrated database retrieval system