KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0618500-01Help
Entry
Os07t0618500-01   CDS       T02163                                 

Gene name
Os07g0618500
Definition
Similar to HPPK/DHPS.
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Os07t0618500-01 (Os07g0618500)
Enzymes [BR:dosa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Os07t0618500-01 (Os07g0618500)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Os07t0618500-01 (Os07g0618500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(25524491..25524664,25524947..25525022,25525110..25526617)
AA seq 585 aa AA seqDB search
SFAFADYQILFPVHSASAPREFFRRPPPPPAPIPIHPASARASRGRTSRSFRCFRRILET
FRKMYSVAKNYCGGGLAASDALSVSALGRSLKPSRKASRHVVPCRARSFTQCSLGGGSAD
QEIVIALGSNVGDRISTFDRALRMMKNSGVNITRHACLYETSPAYVTDQPRFLNSAVRGT
TKLEPHELLKKLKEIEKDIGRTDGIRYGPRPIDLDILLYGKSHISTENLTVPHERIHERP
FVLAPLVDLLGSSTDDNVEKSWHSLAKCTGGFFESWDKLGGESIIGTEGIKRVLPVGNRL
LDWSERTLVMGVLNLTPDSFSDGGKFQEVEAAIAQTKLLISEGADIIDIGAQSTRPLARR
LSADEELERLVPVLDAITGIPEMEGKLLSVDTFYAEVAAEAVKRGVHIVNDVSGGQIDPR
ILEVVAELGVPYVTMHMRGDPSTMQSEQNLLYGDVCKEVASELYKRVRQAELSGIPLWRI
VLDPGIGFSKNSKHNLEVIMGLESIRTEIGKMSLGASHVPILLGPSRKRFLGEICNRVNP
TERDAATMVVATAGILNGANIVRVHNVKYGVDTAKVSDALSKGRR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
agcttcgccttcgcggattaccaaatcctatttcccgtccactcggcgtcggctcctcgt
gagttctttcgccggccgccgccgccgcccgcgccgatccccatccatcccgcaagcgcg
cgcgcgagcaggggccgcacatcgcgttcgttccgctgcttccgccgcatcctggagaca
ttcaggaagatgtactcggttgccaagaactactgcggaggagggttagctgcgtcggat
gcgctatcagtatctgctcttgggcgttctctgaaaccctcgcggaaagcatcgaggcat
gttgttccgtgcagggcgcgctcgtttacgcagtgttccctagggggtggttctgcggac
caggagattgtgattgcactgggcagcaatgtgggggatagaatcagtacgtttgacagg
gcattgcgtatgatgaagaactcgggtgtaaatatcaccaggcatgcctgcttgtatgag
acttccccggcttatgtgactgatcagccgcggttcctgaactctgctgttaggggcaca
accaagctggaacctcatgaattgctcaagaagctaaaggaaattgagaaggatataggg
cgcactgacgggataaggtatggtcccagaccgatcgatctggacattcttctatatggc
aaatcacatattagtactgagaatctaactgtgccacatgaacgcatccatgagaggccg
ttcgttttagcacctcttgttgaccttctaggctcatccactgatgataacgtggaaaaa
agttggcattctcttgcaaagtgcactggtgggttctttgaatcatgggataaacttgga
ggtgaatctataattggaacagaaggaattaaaagggtattgccagtcggaaatcgtctg
ttggattggtctgagaggactcttgtcatgggggtgcttaatttgacaccagacagcttc
agtgatggtggtaagtttcaggaagtggaagctgccattgctcagaccaagttattaata
tcagaaggtgcagacatcattgatattggtgctcaatccactaggccccttgcaagaaga
ttatctgcagacgaagagcttgagaggttggttcctgttctagatgcgatcacaggaatt
cctgagatggaaggcaagctgctctcagtggatacattctatgcagaagtcgctgctgaa
gctgtgaaaagaggagtacacattgttaatgatgtatctggtggacagattgacccaaga
attcttgaagttgtagctgaacttggagttccatatgtgactatgcatatgagaggagat
ccatctactatgcaaagtgaacagaatctactatacggtgatgtttgtaaagaagttgct
tctgagctatataaaagggtgagacaagcagagttgtctgggattcctttgtggaggata
gttcttgatcctggtattggattctccaagaattccaaacataaccttgaagttatcatg
ggtttggaatctattagaacagagataggtaaaatgagtttaggtgcttcacatgtgcca
attttacttggaccctcaaggaaaagatttttaggtgaaatatgcaatcgtgtcaatccc
actgagagagatgctgctaccatggtcgttgctactgctgggatattgaatggtgctaat
atagtaagggtgcataatgttaaatatggcgtggatactgcaaaggtctctgatgcattg
agcaaaggcagaagatga

DBGET integrated database retrieval system