KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0626600-01Help
Entry
Os07t0626600-01   CDS       T02163                                 

Gene name
Os07g0626600
Definition
Similar to Embryogenic callus protein-like.
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Os07t0626600-01 (Os07g0626600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:complement(join(25963325..25963643,25962874..25962962,25962634..25962693,25962211..25962423,25961464..25961532,25961106..25961267,25960853..25960946,25960605..25960747,25959055..25959258))
AA seq 450 aa AA seqDB search
MGSMEASTAPENGTAAAAAAAASTACNGAGGGGGAAAASNGGGVERRLRSSAASASWASH
LPLEVGTRVMCRWRDQKLHPVKVIERRKSSTSSSPADYEYYVHYTEFNRRLDEWVKLEQL
DLETVETDVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIA
KIELGRYEIDTWYFSPFPPEYNDSPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEI
YRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVG
YFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLS
YRGYWTRVLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPK
VLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgatggaggcgtccaccgcgccggagaacggcaccgccgccgccgcggcggcc
gcggcctcgacggcgtgcaacggcgcgggcggcggcggcggcgccgccgccgcctcgaac
ggcggcggggtagagaggaggctgaggtcctccgccgcgtccgcgtcgtgggcgtcgcat
ctgccgctggaggtgggcacgcgcgtgatgtgccggtggcgcgaccagaagctccatccc
gtcaaggtcatcgagcgccggaagtcctccacctcctcctcccccgccgattacgagtac
tacgtccactacaccgagttcaataggaggctcgatgagtgggttaaacttgaacaactt
gatcttgagactgttgagaccgatgttgatgagaaggtagaagataaggcaacaagcttg
aagatgacacggcaccagaagcgtaaaattgatgaaacccatgtggagcaaggtcatgag
gagcttgatgctgctagtttgcgggaacatgaagagttcacaaaggtgaaaaatatagcg
aagatagaacttgggagatatgagatagatacatggtatttctctcctttcccaccggag
tataatgactctccaaagctgttcttctgtgagttttgcctcaacttcatgaagcgcaag
gaacagcttcagaggcacatgaaaaaatgtgatcttaaacatccccctggtgatgaaata
tacagaagtggaaccctgtctatgtttgaggttgatggcaagaagaacaaagtttatggg
cagaacctttgttatcttgccaaactatttcttgatcacaagacactttattacgatgtt
gatttgtttttgttctacgtcctgtgtgaatgtgatgatcgggggtgtcatatggtgggg
tatttctccaaggagaaacactctgaggaatcttacaatttggcttgcatcctcactctc
cctccatatcaaagaaaaggatatgggaagttcctgattgccttctcctatgagctttct
aagaaggaaggtaaagtagggacaccggagcgccctctttctgatcttggtctgctcagt
tatagaggttattggactagagtgcttctagagattttaaagaaacataagagcaacata
tccattaaggagcttagcgatatgacggcaataaaagcggacgacatcttgagcacgctt
cagagtctggacctgatccagtaccggaaaggtcagcacgtcatctgcgctgaccccaag
gttctcgaccgccacctcaaggccgccggccggggtggcctcgaggtcgacgttagcaag
ctgatctggacaccctacaaggaacaaggctaa

DBGET integrated database retrieval system