KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os07t0627000-01Help
Entry
Os07t0627000-01   CDS       T02163                                 

Gene name
Os07g0627000
Definition
Similar to Disproportionating enzyme.
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os07t0627000-01 (Os07g0627000)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Os07t0627000-01 (Os07g0627000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
chr07:join(25980506..25980913,25981447..25981509,25981585..25981673,25981757..25981817,25982003..25982078,25982450..25982589,25982679..25982837,25982931..25983007,25983095..25983234,25983332..25983363,25983457..25983531,25983848..25983920,25984036..25984124,25984235..25984279,25984361..25984513,25984603..25984707)
AA seq 594 aa AA seqDB search
MATLSLPLPHLTQAIPARARPRPRPLRGIPARLLSCRAAMAVAPDKEEAAAVALDKAVKV
AVAAPDRAAVAAVGVGEELPEGYDQMMPAVEEARRRRAGVLLHPTSLRGPHGIGDLGDEA
VAFLAWLRDAGCTLWQVLPLVPPGRKSGEDGSPYSGQDANCGNTLLISLEELVKDGLLME
NELPDPLDMEYVEFDTVANLKEPLIAKAAERLLLSRGELRTQYDCFKKNPNISGWLEDAA
LFAAIDRSIDALSWYEWPEPLKNRHLRALEDIYQKQKDFIEIFMAQQFLFQRQWQRIRKY
AKKLGISIMGDMPIYVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPL
YDWKAMEAGGFEWWIKRINRALDLYDEFRIDHFRGLAGFWAVPSESKVALVGSWRAGPRN
AFFDALFKAVGRINIIAEDLGVITEDVVDLRKSIEAPGMAVLQFAFGGGSDNPHLPHNHE
FDQVVYTGTHDNDTVIGWWQTLPEEEKQTVFKYLPEANRTEISWALITAALSSVARTSMV
TMQDILGLDSSARMNTPATQKGNWRWRMPSSVSFDSLSPEAAKLKELLGLYNRL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctctccctccctctcccgcatctcacccaggccatccccgcgcgagcgcgt
ccgcgaccgcgaccgctccgtgggatccccgcgcggctcctctcctgccgcgccgcgatg
gcggtggcgcccgacaaggaggaggcggcggcggttgctctggacaaggcggtgaaggtg
gcggtggcagctcccgacagggcggcggtggccgcggtgggcgtcggggaggagctcccc
gaggggtacgaccagatgatgccggccgtggaggaggcgcggcggcggcgagccggggtg
ctgctgcacccgacctcgctccgcggcccgcacggcatcggcgacctcggcgacgaggcg
gtcgccttcctcgcctggctccgcgacgccggctgcacgctctggcaggttcttccgctt
gttccaccgggaaggaagtctggggaggatggctctccatattcaggacaggatgcaaac
tgtggtaataccctattaatttcacttgaagagcttgtaaaagatgggttgttgatggag
aatgaactacctgaccccttggatatggagtatgttgaatttgacaccgttgccaatctg
aaagaacctcttattgcaaaggctgcagagaggctcctactgagccgtggagagctcaga
acgcaatatgactgcttcaagaaaaatccaaatatttcaggttggcttgaagatgctgca
ctttttgctgctattgacagaagtattgatgcattatcctggtatgagtggcctgaacct
ctgaaaaaccgacatctcagggccttggaagacatatatcaaaaacagaaggatttcata
gagatatttatggctcaacaattcttatttcaaaggcagtggcagcgaattcgtaaatat
gcaaagaagttgggtatcagcataatgggtgacatgcccatatatgttggctaccatagt
gcagatgtttgggcaaacaggaaatcgtttttgctggacaagaatggttttccgactttt
gttagtggtgttccacctgatgcatttagtgaaactggtcagctttggaacagtccattg
tacgactggaaagctatggaagcaggtggatttgaatggtggataaaaaggattaatcgt
gcccttgatttgtatgatgagttccgtatagaccatttccgggggcttgcaggtttttgg
gcagttccttctgagtcaaaagtagcgctggttggaagctggagggctggaccgaggaat
gcattttttgatgcattattcaaagctgtcggtagaataaacataatagcagaagacctg
ggggtgataacagaagatgttgttgacctaaggaagtctattgaggctcctggaatggca
gttcttcagtttgcttttggcggtggttctgacaatccacacttgccccataaccatgaa
tttgatcaagtagtatacaccggaacacacgacaatgacacggttattggttggtggcaa
actttaccagaggaagagaagcagactgtgttcaagtatctgcctgaggctaataggact
gaaatctcatgggcactgatcactgctgccctctcttcagttgcaaggacatccatggta
accatgcaggacattcttggcctcgacagttctgctagaatgaatactccagctacacag
aaagggaactggagatggaggatgccgagctctgtcagcttcgacagcctcagccctgaa
gcggcgaagctgaaggaattgcttggactgtacaaccggctctaa

DBGET integrated database retrieval system